GABRR1 Polyclonal antibody

• 

  WB analysis of mouse brain using 25899-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25899-1-AP (GABRR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 25899-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 25899-1-AP (GABRR1 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

GABRR1 Polyclonal Antibody for WB, ELISA

Cat No. 25899-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, IP, CoIP, ELISA

Synonyms

GABA(A) receptor subunit rho 1, GABA(C) receptor, GABRR1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IF: See 1 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

25899-1-AP targets GABRR1 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23165

  Product name: Recombinant human GABRR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 19-78 aa of BC130344

  Sequence: RMHWPGREVHEMSKKGSRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLRIDD

• Full Name: gamma-aminobutyric acid (GABA) receptor, rho 1
• Calculated Molecular Weight: 479 aa, 56 kDa
• Observed Molecular Weight: 50-56 kDa
• GenBank Accession Number: BC130344
• Gene Symbol: GABRR1
• Gene ID (NCBI): 2569
• RRID: AB_2880290
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P24046
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GABRR1 is a member of a family of ligand-gated chloride channels that are the major inhibitory neurotransmitter receptors in the central nervous system. GABRR1 acts as a rho-1 receptor of GABA, the major inhibitory neurotransmitter in the vertebrate brain, may play a role in retinal neurotransmission. And then, GABRR1 is highly expressed in the retina and in a lesser extent in brain, lung and thymus. There are 3 isoforms for GABRR1 produced by alternative splicing, with the molecular weights of 46 kDa, 53 kDa, 56 kDa, respectively.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	IF	Insect Sci; Rho 1 participates in parasitoid wasp eggs maturation and host cellular immunity inhibition; Authors - Ruijuan Wang
mouse	WB,IP,CoIP	Biochem Biophys Res Commun; Extraction method combining saponin and trehalose useful for analyzing fragile intermolecular association; Authors - Takahiro Fujimoto
mouse	WB	Transl Psychiatry; Acute stress induces severe neural inflammation and overactivation of glucocorticoid signaling in interleukin-18-deficient mice; Authors - Kyosuke Yamanishi