Tested Applications
| Positive WB detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13747-1-AP targets GADD45A in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, goat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4687 Product name: Recombinant human GADD45A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 5-165 aa of BC011757 Sequence: EFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLAADEDDDRDVALQIHFTLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER Predict reactive species |
| Full Name | growth arrest and DNA-damage-inducible, alpha |
| Calculated Molecular Weight | 165 aa, 18 kDa |
| Observed Molecular Weight | 18 kDa, 33 kDa |
| GenBank Accession Number | BC011757 |
| Gene Symbol | GADD45A |
| Gene ID (NCBI) | 1647 |
| RRID | AB_2108058 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P24522 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GADD45A, also named as DDIT1 and GADD45, belongs to the GADD45 family. It binds to proliferating cell nuclear antigen. GADD45A may affect PCNA interaction with some CDK (cell division protein kinase) complexes; stimulates DNA excision repair in vitro and inhibits entry of cells into S phase. GADD45A plays an essential role in active DNA demethylation during terminal osteogenic differentiation of adipose-derived mesenchymal stem cells. GADD45A has Dimer (~28-36 kDa) and Monomer (14-18 kDa) forms (PMID:11498536).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GADD45A antibody 13747-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
13747-1-AP is an anti-GADD45A antibody with 24 total citations. It appears in journals including Cell Research, Journal of Experimental & Clinical Cancer Research, Advanced Science, International Journal of Biological Sciences, Cells, FASEB Journal, and Scientific Reports. Research fields span DNA damage repair, apoptosis, cell cycle regulation, cancer biology (lung, bladder, ovarian, pancreatic, renal, melanoma), neurodegeneration, oxidative stress, endoplasmic reticulum stress, viral replication, and developmental disorders.
| Species | Application | Title |
|---|---|---|
Cell Res DNA damage triggers tubular endoplasmic reticulum extension to promote apoptosis by facilitating ER-mitochondria signaling. | ||
J Exp Clin Cancer Res Flavagline analog FL3 induces cell cycle arrest in urothelial carcinoma cell of the bladder by inhibiting the Akt/PHB interaction to activate the GADD45α pathway.
| ||
Adv Sci (Weinh) HIGD1A Alleviates Oxidative Stress Related Ovarian Hypofunction by Enhancing Granulosa Cell Functions via NF-κB/SOD2 Signaling Pathway | ||
Int J Biol Sci MFP-FePt-GO Nanocomposites Promote Radiosensitivity of Non-Small Cell Lung Cancer Via Activating Mitochondrial-Mediated Apoptosis and Impairing DNA Damage Repair. | ||
Int J Nanomedicine TiO2 Nanoparticles Caused DNA Damage in Lung and Extra-Pulmonary Organs Through ROS-Activated FOXO3a Signaling Pathway After Intratracheal Administration in Rats. | ||
Neural Regen Res Silencing Huwe1 reduces apoptosis of cortical neurons exposed to oxygen-glucose deprivation and reperfusion. |
Reviews
What customers say
One customer reviewed this antibody with a 5-star rating. They used it for Western Blot on mouse liver tissue at a 1:1000 dilution and reported that the antibody works well when diluted in 1x TBST. Overall, the feedback is positive, confirming reliable performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Kamal (Verified Customer) (02-27-2025) | Antibody works well when diluted in 1x TBST.
![]() |


