GADL1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GADL1 Polyclonal antibody, PBS Only (18240-1-PBS)

• 

  WB analysis of mouse cerebellum using 18240-1-AP (same clone as 18240-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 18240-1-AP (GADL1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18240-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 18240-1-AP (same clone as 18240-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 18240-1-AP (GADL1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18240-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 18240-1-AP (same clone as 18240-1-PBS)

  IP result of anti-GADL1 (IP:18240-1-AP, 4ug; Detection:18240-1-AP 1:300) with mouse brain tissue lysate 4000ug. This data was developed using the same antibody clone with 18240-1-PBS in a different storage buffer formulation.

GADL1 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 18240-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, Indirect ELISA

Synonyms

EC:4.1.1.11, Cysteine sulfinic acid decarboxylase, CSADC, Aspartate 1-decarboxylase, ADC

---

Product Information

18240-1-PBS targets GADL1 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13005

  Product name: Recombinant human GADL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-337 aa of BC093701

  Sequence: MYAMNLARYKYCPDIKEKGLSGSPRLILFTSAECHYSMKKAASFLGIGTENVCFVETDGRGKMIPEELEKQVWQARKEGAAPFLVCATSGTTVLGAFDPLDEIADICERHSLWLHVDASWGGSALMSRKHRKLLHGIHRADSVAWNPHKMLMAGIQCCALLVKDKSDLLKKCYSAKASYLFQQDKFYDVSYDTGDKSIQCSRRPDAFKFWMTWKALGTLGLEERVNRALALSRYLVDEIKKREGFKLLMEPEYANICFWYIPPSLREMEEGPEFWAKLNLVAPAIKERMMKKGSLMLGYQPHRGKVNFFRQVVISPQVSREDMDFLLDEIDLLGKDM

• Full Name: glutamate decarboxylase-like 1
• Calculated Molecular Weight: 39 kDa, 59 kDa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC093701
• Gene Symbol: GADL1
• Gene ID (NCBI): 339896
• RRID: AB_10699874
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZQY3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.