GAGE1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GAGE1 Polyclonal antibody, PBS Only (12795-1-PBS)

• 

  WB analysis of Jurkat using 12795-1-AP (same clone as 12795-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12795-1-AP (GAGE1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12795-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12795-1-AP (same clone as 12795-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer using 12795-1-AP (GAGE1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 12795-1-PBS in a different storage buffer formulation.

GAGE1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12795-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12795-1-PBS targets GAGE1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3534

  Product name: Recombinant human GAGE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-139 aa of BC036094

  Sequence: MSWRGRSTYYWPRPRRYVQPPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPKPEADSQEQGHPQTGCECEDGPDGQEMDPPNPEEVKTPEEEMRSHYVAQTGILWLLMNNCFLNLSPRKP

• Full Name: G antigen 1
• Calculated Molecular Weight: 139 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC036094
• Gene Symbol: GAGE1
• Gene ID (NCBI): 2543
• RRID: AB_2108363
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P0DTW1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.