GALE Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GALE Polyclonal antibody (14414-1-AP)

• Featured Product
• KD/KO Validated

GALE Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14414-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

EC:5.1.3.2, EC:5.1.3.7, SDR1E1, UDP-galactose 4-epimerase, UDP-GalNAc 4-epimerase

• 

  WB analysis using 14414-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14414-1-AP (GALE antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 14414-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 14414-1-AP (GALE antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 14414-1-AP

  IP result of anti-GALE (IP:14414-1-AP, 4ug; Detection:14414-1-AP 1:300) with HeLa cells lysate 1080ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 14414-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma using 14414-1-AP (GALE antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 14414-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma using 14414-1-AP (GALE antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 14414-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GALE antibody (14414-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A375 cells, MCF-7 cells, HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human malignant melanoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14414-1-AP targets GALE in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5756

  Product name: Recombinant human GALE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-348 aa of BC050685

  Sequence: MAEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRRVQELTGRSVEFEEMDILDQGALQRLFKKYSFMAVIHFAGLKAVGESVQKPLDYYRVNLTGTIQLLEIMKAHGVKNLVFSSSATVYGNPQYLPLDEAHPTGGCTNPYGKSKFFIEEMIRDLCQADKTWNAVLLRYFNPTGAHASGCIGEDPQGIPNNLMPYVSQVAIGRREALNVFGNDYDTEDGTGVRDYIHVVDLAKGHIAALRKLKEQCGCRIYNLGTGTGYSVLQMVQAMEKASGKKIPYKVVARREGDVAACYANPSLAQEELGWTAALGLDRMCEDLWRWQKQNPSGFGTQA

• Full Name: UDP-galactose-4-epimerase
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC050685
• Gene Symbol: GALE
• Gene ID (NCBI): 2582
• RRID: AB_2108540
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14376
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GALE(Galactowaldenase) is also named as UDP-glucose 4-epimerase, UDP-galactose 4-epimerase, and belongs to the sugar epimerase family. UDP-galactose 4-epimerase catalyzes the interconversion of UDP-glucose and UDP-galactose during normal galactose metabolism. In humans, deficiencies in this enzyme lead to the complex disorder referred to as epimerase-deficiency galactosemia(PMID:10801319).It can exsit as a homodimer(PMID:8931134).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Redox Biol; Hypoxic acclimation improves cardiac redox homeostasis and protects heart against ischemia-reperfusion injury through upregulation of O-GlcNAcylation.; Authors - Wei Ou
human	WB,IHC	PLoS One; Angelica Sinensis Polysaccharides Stimulated UDP-Sugar Synthase Genes through Promoting Gene Expression of IGF-1 and IGF1R in Chondrocytes: Promoting Anti-Osteoarthritic Activity.; Authors - Yinxian Wen
human	WB	Infect Drug Resist; iTRAQ-Based Proteomics Reveals Potential Anti-Virulence Targets for ESBL-Producing Klebsiella pneumoniae.; Authors - Yan Wang
human	WB,IHC	Biochem Biophys Res Commun; The critical role of UDP-galactose-4-epimerase in osteoarthritis: modulating proteoglycans synthesis of articular chondrocytes.; Authors - Yinxian Wen ; KD Validated
mouse	WB	Cell Metab; Glucose-dependent glycosphingolipid biosynthesis fuels CD8(+) T cell function and tumor control.; Authors - Joseph Longo