GALM Recombinant monoclonal antibody

• 

  WB analysis using 86369-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 86369-1-RR (GALM antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

GALM Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 86369-1-RR

Clone No.251049A8

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Aldose 1-epimerase, BLOCK25, EC:5.1.3.3, IBD1

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, SK-N-SH cells, SH-SY5Y cells, mouse kidney tissue, rat kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86369-1-RR targets GALM in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8842

  Product name: Recombinant human GALM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-342 aa of BC019263

  Sequence: MASVTRAVFGELPSGGGTVEKFQLQSDLLRVDIISWGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAKGTFKVDGKEYHLAINKEPNSLHGGVRGFDKVLWTPRVLSNGVQFSRISPDGEEGYPGELKVWVTYTLDGGELIVNYRAQASQATPVNLTNHSYFNLAGQASPNINDHEVTIEADTYLPVDETLIPTGEVAPVQGTAFDLRKPVELGKHLQDFHLNGFDHNFCLKGSKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPKHSGFCLETQNWPDAVNQPRFPPVLLRPGEEYDHTTWFKFSVA

• Full Name: galactose mutarotase (aldose 1-epimerase)
• Calculated Molecular Weight: 342 aa, 38 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC019263
• Gene Symbol: GALM
• Gene ID (NCBI): 130589
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96C23
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GALM, also named as Aldose 1-epimerase, belongs to the aldose epimerase family. GALM is a mutarotase that catalyzes the interconversion of beta-D-galactose and alpha-D-galactose during galactose metabolism. GALM is involved in the maintenance of the equilibrium between the beta- and alpha-anomers of galactose, therefore ensuring a sufficient supply of the alpha-anomer for GALK1. GALM is also active on D-glucose, but its preference for galactose is higher than that of glucose. The calculated molecular weight of GALM is 38 kDa.