GALNT10 Polyclonal antibody

GALNT10 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 20822-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

GalNAc T10, GalNAcT10, GALNT10, pp GalNAc T10, pp GaNTase 10

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSK-N-SH cells, HepG2 cells, mouse ovary tissue
Positive IHC detected inhuman liver cancer tissue, human ovary tumor tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20822-1-AP targets GALNT10 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14751

Product name: Recombinant human GALNT10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 400-603 aa of BC007224

Sequence: EYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN

Predict reactive species
Full Name UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10)
Calculated Molecular Weight 603 aa, 69 kDa
Observed Molecular Weight62 kDa
GenBank Accession NumberBC007224
Gene Symbol GALNT10
Gene ID (NCBI) 55568
RRIDAB_3085622
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86SR1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GALNT10 is a member of the N-acetylgalactosyltransferase family and an enzyme that catalyzes the first step in O-glycan synthesis. O-glycosylation is closely related to cell recognition, tumor cell growth, metastasis and adhesion. GALNT10 can change the cell connection and communication environment between cells, thus achieving specific biological effects. GALNT10 is highly expressed in many tumors and the tumor migration and invasion ability can be suppressed by inhibiting the expression of GALNT10 (PMID: 33275228). GALNT10 is a prognostic biomarker of high-grade ovarian serous cancer (HGSC) patients (PMID: 31853576). GALNT10 has 4 isoforms with the molecular mass of 32, 41, 62 and 69 kDa.

Protocols

Product Specific Protocols
WB protocol for GALNT10 antibody 20822-1-APDownload protocol
IHC protocol for GALNT10 antibody 20822-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...