GALNT3 Polyclonal antibody

• 

  WB analysis of PC-3 using 16716-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse testis using 16716-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of DU 145 using 16716-1-AP

  DU 145 cells were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16716-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of mouse liver using 16716-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  IHC staining of mouse kidney using 16716-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16716-1-AP (GALNT3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 16716-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16716-1-AP (GALNT3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GALNT3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16716-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

EC:2.4.1.41, GalNAc T3, GalNAc-T3, HFTC, HHS

---

Tested Applications

• Positive WB detected in: PC-3 cells, DU 145 cells, mouse testis tissue, mouse liver tissue, HeLa cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below
• IHC: See 3 publications below

Product Information

16716-1-AP targets GALNT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10140

  Product name: Recombinant human GALNT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC056246

  Sequence: MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPEYVEE

• Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3)
• Calculated Molecular Weight: 633aa,73 kDa; 192aa,22 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC056246
• Gene Symbol: GALNT3
• Gene ID (NCBI): 2591
• RRID: AB_2878303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14435
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Cycle; LINC02535/miR-30a-5p/GALNT3 axis contributes to lung adenocarcinoma progression via the NF- κ B signaling pathway.; Authors - Yue Li
mouse	IHC	Bone; Growth-related skeletal changes and alterations in phosphate metabolism.; Authors - Toshimi Michigami
human	WB	J Exp Clin Cancer Res; LINC01296/miR-26a/GALNT3 axis contributes to colorectal cancer progression by regulating O-glycosylated MUC1 via PI3K/AKT pathway.; Authors - Bing Liu
human	IHC	Hum Cell; GalNAc-T3 and MUC1, a combined predictor of prognosis and recurrence in solitary pulmonary adenocarcinoma initially diagnosed as malignant solitary pulmonary nodule (≤ 3 cm).; Authors - Qiang Xie
rat	WB	Exp Ther Med; PMID: 29805509; Authors - Yanshao Liu
mouse	WB	Environ Toxicol; Cisplatin induces acute kidney injury by downregulating miR-30e-5p that targets Galnt3 to activate the AMPK signaling pathway; Authors - Weipu Mao