GALNT3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GALNT3 Polyclonal antibody (16716-1-AP)

GALNT3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16716-1-AP Copied!

Publications (9)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, ELISA

Synonyms

EC:2.4.1.41, GalNAc T3, GalNAc-T3, HFTC, HHS

• 

  WB analysis using 16716-1-AP

  Mouse testis tissue were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16716-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of DU 145 using 16716-1-AP

  DU 145 cells were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 16716-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 16716-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 16716-1-AP (GALNT3 Antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 16716-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16716-1-AP (GALNT3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 16716-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 16716-1-AP (GALNT3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GALNT3 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, DU 145 cells, HeLa cells, mouse liver tissue, PC-3 cells
• Positive IHC detected in: mouse kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16716-1-AP targets GALNT3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10140

  Product name: Recombinant human GALNT3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC056246

  Sequence: MAHLKRLVKLHIKRHYHKKFWKLGAVIFFFIIVLVLMQREVSVQYSKEESRMERNMKNKNKMLDLMLEAVNNIKDAMPKMQIGAPVRQNIDAGERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKAFKTTNLSVEEQKEKERGEAKHCFNAFASDRISLHRDLGPDTRPPEYVEE

• Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 3 (GalNAc-T3)
• Calculated Molecular Weight: 633aa,73 kDa; 192aa,22 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC056246
• Gene Symbol: GALNT3
• Gene ID (NCBI): 2591
• RRID: AB_2878303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14435
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GALNT3 antibody (catalog number 16716-1-AP) has 9 total citations. These appear in journals including Journal of Experimental & Clinical Cancer Research, Environmental Toxicology, Cell Cycle, Bone, Carbohydrate Research, Human Cell, Biochemical & Biophysical Research Communications, and Experimental & Therapeutic Medicine. The associated research fields span oncology (colorectal and lung cancer), acute kidney injury, phosphate metabolism and skeletal growth, O-GalNAc glycosylation, atherosclerosis, and spermatogenic cell apoptosis. Applications cited include Western blot and immunohistochemistry across human, mouse, and rat samples.

Automatically generated from the 9 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Exp Clin Cancer Res; LINC01296/miR-26a/GALNT3 axis contributes to colorectal cancer progression by regulating O-glycosylated MUC1 via PI3K/AKT pathway.; Authors - Bing Liu
mouse,human	WB,IHC	Environ Toxicol; Downregulation of circ-RAPGEF5 inhibits colorectal cancer progression by reducing the expression of polypeptide N-acetylgalactosaminyltransferase 3 (GALNT3); Authors - Duo Cheng
mouse	WB	Environ Toxicol; Cisplatin induces acute kidney injury by downregulating miR-30e-5p that targets Galnt3 to activate the AMPK signaling pathway; Authors - Weipu Mao
mouse	IHC	Bone; Growth-related skeletal changes and alterations in phosphate metabolism.; Authors - Toshimi Michigami
human	WB	Cell Cycle; LINC02535/miR-30a-5p/GALNT3 axis contributes to lung adenocarcinoma progression via the NF- κ B signaling pathway.; Authors - Yue Li
		Carbohydr Res; Identification of O-GalNAc-modified proteins interacting with GALNT3 using proximity labeling method; Authors - Bo Xu

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

The product received a 5-star rating from a user who tested it on human cancer tissue using immunohistochemistry. The reviewer reported that it works well for IHC applications, confirming reliable performance in their workflow.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Jennifer (Verified Customer) (04-24-2026)

Works well for IHC

• Applications: Immunohistochemistry
• Cell Tissue Type: human cancer tissue