GALNT6 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GALNT6 Polyclonal antibody (13671-1-AP)

• 

  WB analysis using 13671-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13671-1-AP (GALNT6 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung squamous cell cancer using 13671-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell cancer slide using 13671-1-AP (GALNT6 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung squamous cell cancer using 13671-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung squamous cell cancer slide using 13671-1-AP (GALNT6 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 13671-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13671-1-AP (GALNT6 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 13671-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13671-1-AP (GALNT6 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 13671-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GALNT6 antibody (13671-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).

• 

  IF Staining of A431 using 13671-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using GALNT6 antibody (13671-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Beta Actin antibody (66009-1-Ig, Clone: 2D4H5, red).

GALNT6 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 13671-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

EC:2.4.1.41, GALNAC T6, GalNAcT6, GalNAc-T6, Polypeptide N-acetylgalactosaminyltransferase 6

---

Tested Applications

• Positive WB detected in: A431 cells, MCF-7 cells, T-47D cells
• Positive IHC detected in: human lung squamous cell cancer, human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13671-1-AP targets GALNT6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4652

  Product name: Recombinant human GALNT6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 323-622 aa of BC035822

  Sequence: FDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFSISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHNFSWYLHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTTQRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELAQDQLIRNSGSGTCLTSQDKKPAMAPCNPSDPHQLWLFV

• Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 6 (GalNAc-T6)
• Calculated Molecular Weight: 622 aa, 71 kDa
• Observed Molecular Weight: 71 kDa
• GenBank Accession Number: BC035822
• Gene Symbol: GALNT6
• Gene ID (NCBI): 11226
• RRID: AB_3669168
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NCL4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GALNT6 (polypeptide N-acetylgalactosaminyltransferase 6, GalNAc-T6), which is involved in the initiation of O-glycosylation, has been reported to play crucial roles in mammary carcinogenesis through binding to several substrates (PMID: 32393740). GALNT6 is upregulated in breast, ovarian, renal cell, lung and pancreatic cancers (PMID: 20215525). Overexpression of GRP78 could enhance Golgi-to-ER relocation of GALNT6 (PMID: 28110670).

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Jennifer (Verified Customer) (04-22-2026)

Works well for western blotting and IHC.

• Applications: Western Blot, Immunohistochemistry
• Cell Tissue Type: Human cell lines and tissue