GALNT8 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GALNT8 Polyclonal antibody (24025-1-AP)

• 

  WB analysis using 24025-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24025-1-AP (GALNT8 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 24025-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24025-1-AP (GALNT8 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

GALNT8 Polyclonal Antibody for WB, ELISA

Cat No. 24025-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

pp GaNTase 8, GALNAC T8

---

Tested Applications

• Positive WB detected in: HCT 116 cells, MCF-7 cells, SH-SY5Y cells, Y79 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24025-1-AP targets GALNT8 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21185

  Product name: Recombinant human GALNT8 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 522-637 aa of BC140889

  Sequence: MYYCHEFSSQNVYYHLTGELYVGQLIAEASASDRCLTDPGKAEKPTLEPCSKAAKNRLHIYWDFKPGGAVINRDTKRCLEMKKDLLGSHVLVLQTCSTQVWEIQHTVRDWGQTNSQ

• Full Name: UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 8 (GalNAc-T8)
• Calculated Molecular Weight: 637 aa, 73 kDa
• Observed Molecular Weight: 73 kDa, 95 kDa
• GenBank Accession Number: BC140889
• Gene Symbol: GALNT8
• Gene ID (NCBI): 26290
• RRID: AB_3742101
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY28
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GALNT8 (Probable polypeptide N-acetylgalactosaminyltransferase 8) is a member of the UDP-GalNAc polypeptide N-acetylgalactosaminyl transferase (ppGaNTase) family, which initiates mucin-like O-linked protein glycosylation in the Golgi apparatus. The tissue distribution of GALNT8 is high in the heart, skeletal muscle, kidney and liver; moderate in the placenta, small intestine, leukocyte and lung; and weak in the brain, colon, thymus and spleen (PMID: 34576978). The overexpression of GALNT8 significantly promotes the cell cycle and proliferation of CRC cell lines and correlates with poor prognosis in patients with CRC. GALNT8 encodes a 637-amino-acid type-II membrane protein (GalNAc-T8). The detected molecular weight of GALNT8 (95 kDa) is much higher than the theoretical molecular weight (70 kDa) due to three N-GlcNAc sites (N85, N107 and N160) (PMID: 34743989, 34239555).