GALP Polyclonal antibody

• 

  WB analysis of fetal human brain using 25116-1-AP

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 25116-1-AP (GALP Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SH-SY5Y using 25116-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 25116-1-AP (GALP Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

GALP Polyclonal Antibody for WB, ELISA

Cat No. 25116-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

galanin like peptide, GALP

---

Tested Applications

• Positive WB detected in: fetal human brain tissue, SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25116-1-AP targets GALP in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18928

  Product name: Recombinant human GALP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 43-116 aa of BC148722

  Sequence: LGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS

• Full Name: galanin-like peptide
• Calculated Molecular Weight: 116 aa, 13 kDa
• Observed Molecular Weight: 5 kDa
• GenBank Accession Number: BC148722
• Gene Symbol: GALP
• Gene ID (NCBI): 85569
• RRID: AB_2879904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBC7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.