GANC Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84676-3-RR (same clone as 84676-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84676-3-RR (GANC antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84676-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84676-3-RR (same clone as 84676-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84676-3-RR (GANC antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84676-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 84676-3-RR (same clone as 84676-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 84676-3-RR (GANC antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84676-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84676-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84676-3-RR against Human GANC were performed. The affinity constant is below 1 pM.

GANC Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84676-3-PBS

Clone No.242060G3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

242060G3

---

Product Information

84676-3-PBS targets GANC in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag35067

  Product name: Recombinant human GANC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 50-210 aa of BC059406

  Sequence: VTTDEDSTRFQIINEASKVPLLAEIYGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGSLILADGKGDLKCHITANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEETSVDTSQENQEDLGLWEEKFGKFVDIKANGP

• Full Name: glucosidase, alpha; neutral C
• Calculated Molecular Weight: 104 kDa
• Observed Molecular Weight: 100-105 kDa
• GenBank Accession Number: BC059406
• Gene Symbol: GANC
• Gene ID (NCBI): 2595
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8TET4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GANC (Glucosidase Alpha, Neutral C) is a Protein Coding gene. Diseases associated with GANC include Pompe Disease and Autosomal Recessive Limb-Girdle Muscular Dystrophy Type 2A.