GAR1 Polyclonal antibody

• 

  WB analysis of HeLa using 11711-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11711-1-AP (GAR1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 11711-1-AP

  IP result of anti-GAR1 (IP:11711-1-AP, 4ug; Detection:11711-1-AP 1:1000) with HeLa cells lysate 1400 ug.

• 

  IHC staining of human colon using 11711-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 11711-1-AP (GAR1 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon using 11711-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 11711-1-AP (GAR1 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

GAR1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 11711-1-AP

Publications(17)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, CoIP, ELISA

Synonyms

NOLA1, snoRNP protein GAR1

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 12 publications below
• IHC: See 4 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

11711-1-AP targets GAR1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2282

  Product name: Recombinant human GAR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC003413

  Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH

• Full Name: GAR1 ribonucleoprotein homolog (yeast)
• Calculated Molecular Weight: 217 aa, 22 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC003413
• Gene Symbol: GAR1
• Gene ID (NCBI): 54433
• RRID: AB_2081845
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NY12
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GAR1, other named NOLA1, is a subunit of H/ACA and telomerase. Thought is not required for H/ACA protein assembly, GAR1 is necessary for ribosome biogenesis and telomere. H/ACA involves in class specify the sites of uridine-to-pseudouridine. It contains a core domain that flanked by glycine- and arginine-rich(GAR) domains. GAR1 also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transciptase(TERT) holoenzyme.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; The human base excision repair enzyme SMUG1 directly interacts with DKC1 and contributes to RNA quality control.; Authors - Laure Jobert
human	WB	Genome Biol; Human dyskerin binds to cytoplasmic H/ACA-box-containing transcripts affecting nuclear hormone receptor dependence; Authors - Federico Zacchini
human	WB	Front Cell Dev Biol; PARP1 Regulates the Biogenesis and Activity of Telomerase Complex Through Modification of H/ACA-Proteins.; Authors - Nikita V Savelyev
human	WB	Mol Cell Biol; SUMOylation- and GAR1-Dependent Regulation of Dyskerin Nuclear and Subnuclear Localization.; Authors - D E MacNeil
human	IHC	Pathology; Expressional analysis of NOLA1, NOLA2, NOLA3 and DKC1, the core proteins in H/ACA riboproteins, in gastric and colorectal cancers.; Authors - Kim Min Sung MS
human	WB	Histochem Cell Biol; Differential requirements for H/ACA ribonucleoprotein components in cell proliferation and response to DNA damage.; Authors - Ping Lin