GAR1 Recombinant monoclonal antibody, PBS Only (Detector)

GAR1 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 83577-1-PBS
Clone No.240537C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Cytometric bead array, Indirect ELISA

240537C11, NOLA1, snoRNP protein GAR1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83577-1-PBS targets GAR1 as part of a matched antibody pair:

MP00568-1: 83577-2-PBS capture and 83577-1-PBS detection (validated in Cytometric bead array)

MP00568-2: 83577-3-PBS capture and 83577-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2282

Product name: Recombinant human GAR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-217 aa of BC003413

Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH

Predict reactive species
Full Name GAR1 ribonucleoprotein homolog (yeast)
Calculated Molecular Weight 217 aa, 22 kDa
GenBank Accession NumberBC003413
Gene Symbol GAR1
Gene ID (NCBI) 54433
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NY12
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GAR1, other named NOLA1, is a subunit of H/ACA and telomerase. Thought is not required for H/ACA protein assembly, GAR1 is necessary for ribosome biogenesis and telomere. H/ACA involves in class specify the sites of uridine-to-pseudouridine. It contains a core domain that flanked by glycine- and arginine-rich(GAR) domains. GAR1 also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transciptase(TERT) holoenzyme.

Loading...
||
New chat

Able

正在加载,请稍候...