Use Able AI chat for product recommendations

GAR1 Recombinant monoclonal antibody, PBS Only (Detector)

GAR1 Uni-rAb® Recombinant Antibody for IHC, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 83577-1-PBS
Clone No.240537C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, Cytometric bead array, Indirect ELISA

240537C11, NOLA1, snoRNP protein GAR1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83577-1-PBS targets GAR1 as part of a matched antibody pair:

MP00568-1: 83577-2-PBS capture and 83577-1-PBS detection (validated in Cytometric bead array)

MP00568-2: 83577-3-PBS capture and 83577-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2282

Product name: Recombinant human GAR1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-217 aa of BC003413

Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH

Predict reactive species
Full Name GAR1 ribonucleoprotein homolog (yeast)
Calculated Molecular Weight 217 aa, 22 kDa
GenBank Accession NumberBC003413
Gene Symbol GAR1
Gene ID (NCBI) 54433
RRIDAB_3671188
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NY12
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GAR1, other named NOLA1, is a subunit of H/ACA and telomerase. Thought is not required for H/ACA protein assembly, GAR1 is necessary for ribosome biogenesis and telomere. H/ACA involves in class specify the sites of uridine-to-pseudouridine. It contains a core domain that flanked by glycine- and arginine-rich(GAR) domains. GAR1 also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transciptase(TERT) holoenzyme.

Loading...
||
New chat

Able

正在加载,请稍候...