GAR1 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GAR1 Recombinant monoclonal antibody, PBS Only (83577-4-PBS)

• 

  WB analysis using 83577-4-RR (same clone as 83577-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83577-4-RR (GAR1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83577-4-PBS in a different storage buffer formulation.

• 

  FC experiment of K562 using 83577-4-RR (same clone as 83577-4-PBS)

  1x10^6 K562 were intracellularly stained with 0.2 ug GAR1 Recombinant antibody (83577-4-RR, Clone:240537A2) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.2 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 83577-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83577-4-RR

  Biolayer interferometry (BLl) kinetic assays of 83577-4-RR against Human GAR1 were performed. The affinity constant is 1.18 nM.

GAR1 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83577-4-PBS

Clone No.240537A2

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

Synonyms

snoRNP protein GAR1, NOLA1, 240537A2

---

Product Information

83577-4-PBS targets GAR1 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2282

  Product name: Recombinant human GAR1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC003413

  Sequence: MSFRGGGRGGFNRGGGGGGFNRGGSSNHFRGGGGGGGGGNFRGGGRGGFGRGGGRGGFNKGQDQGPPERVVLLGEFLHPCEDDIVCKCTTDENKVPYFNAPVYLENKEQIGKVDEIFGQLRDFYFSVKLSENMKASSFKKLQKFYIDPYKLLPLQRFLPRPPGEKGPPRGGGRGGRGGGRGGGGRGGGRGGGFRGGRGGGGGGFRGGRGGGFRGRGH

• Full Name: GAR1 ribonucleoprotein homolog (yeast)
• Calculated Molecular Weight: 217 aa, 22 kDa
• GenBank Accession Number: BC003413
• Gene Symbol: GAR1
• Gene ID (NCBI): 54433
• RRID: AB_3671189
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9NY12
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GAR1, other named NOLA1, is a subunit of H/ACA and telomerase. Thought is not required for H/ACA protein assembly, GAR1 is necessary for ribosome biogenesis and telomere. H/ACA involves in class specify the sites of uridine-to-pseudouridine. It contains a core domain that flanked by glycine- and arginine-rich(GAR) domains. GAR1 also required for correct processing or intranuclear trafficking of TERC, the RNA component of the telomerase reverse transciptase(TERT) holoenzyme.