GAT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GAT1 Polyclonal antibody (20298-1-AP)

GAT1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 20298-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse , rat

Applications

WB, IHC, ELISA

Synonyms

GABA Transporter 1, GABATHG, GABATR, GABT1, GAT 1, GAT1, SLC6A1

• 

  WB analysis using 20298-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20298-1-AP (GAT1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 20298-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 20298-1-AP (GAT1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse cerebellum using 20298-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 20298-1-AP (GAT1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GAT1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, mouse testis tissue, rat testis tissue
• Positive IHC detected in: mouse cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20298-1-AP targets GAT1 in WB, IHC, ELISA applications and shows reactivity with human, mouse , rat samples.

• Tested Reactivity: human, mouse , rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14109

  Product name: Recombinant human SLC6A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 518-599 aa of BC033904

  Sequence: QMTQLTMGNYVFPKWGQGVGWLMALSSMVLIPGYMAYMFLTLKGSLKQRIQVMVQPSEDIVRPENGPEQPQAGSSTSKEAYI

• Full Name: solute carrier family 6 (neurotransmitter transporter, GABA), member 1
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 42 kDa, 67 kDa
• GenBank Accession Number: BC033904
• Gene Symbol: GABA Transporter 1/GAT1
• Gene ID (NCBI): 6529
• RRID: AB_2878664
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P30531
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GAT1 Polyclonal antibody (Cat# 20298-1-AP) has 1 citation. It appears in Chinese Medicine (Chin Med), a journal with an impact factor of 7.4. The cited study investigated the effect of modified Qiyuan paste on mice with low immunity and sleep deprivation by regulating the GABA nerve and immune system, using WB and IHC applications in mouse models.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IHC	Chin Med; The effect of modified Qiyuan paste on mice with low immunity and sleep deprivation by regulating GABA nerve and immune system; Authors - Mei Rong