GATA2 Monoclonal antibody, PBS Only

• 

  WB analysis using 67722-1-Ig (same clone as 67722-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of bEnd.3 using 67722-1-Ig (same clone as 67722-1-PBS)

  bEnd.3 cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67722-1-Ig (same clone as 67722-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 67722-1-Ig (same clone as 67722-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 67722-1-Ig (same clone as 67722-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67722-1-Ig (same clone as 67722-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67722-1-Ig (same clone as 67722-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67722-1-Ig (same clone as 67722-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of LNCaP using 67722-1-Ig (same clone as 67722-1-PBS)

  LNCaP cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HUVEC using 67722-1-Ig (same clone as 67722-1-PBS)

  HUVEC cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-12 using 67722-1-Ig (same clone as 67722-1-PBS)

  PC-12 cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67722-1-Ig (same clone as 67722-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67722-1-Ig (GATA2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  IF Staining of SH-SY5Y using 67722-1-Ig (same clone as 67722-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using GATA2 antibody (67722-1-Ig, Clone: 2B5A1 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K-562 using 67722-1-Ig (same clone as 67722-1-PBS)

  1X10^6 K-562 cells were intracellularly stained with 0.5 ug Anti-Human GATA2 (67722-1-Ig, Clone:2B5A1) (red) labeled with FlexAble CoraLite® Plus 555 Antibody Labeling Kit for Mouse IgG1 (KFA022), or 0.5 ug Control Antibody. Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67722-1-PBS in a different storage buffer formulation.

GATA2 Monoclonal Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 67722-1-PBS

Clone No.2B5A1

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

2B5A1, Endothelial transcription factor GATA-2, GATA binding protein 2, GATA-binding protein 2, NFE1B

---

Product Information

67722-1-PBS targets GATA2 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1557

  Product name: Recombinant human GATA2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 168-467 aa of BC018988

  Sequence: SHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG

• Full Name: GATA binding protein 2
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC018988
• Gene Symbol: GATA2
• Gene ID (NCBI): 2624
• ENSEMBL Gene ID: ENSG00000179348
• RRID: AB_2882909
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23769
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GATA2 is a member of GATA family of transcription factors that contains zinc fingers in DNA binding domain. GATA2 acts as a transcriptinal activator that regulates endothelin-1 expression in endothelial cells. Together with GATA3, GATA2 regulates adipocyte differentiation through molecular control of the preadpocyte-adipocyte transition. It also affect the activity of Rho inhibitor p190RhoGAP that controls capillary network formation in vitro and retinal angiogenesis in vivo.