GATA3 Monoclonal antibody

GATA3 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA
Cat No. 66400-1-Ig
Clone No.1B11A8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse and More (2)

Applications

WB, IHC, IF/ICC, IF-P, CoIP, ELISA

Trans-acting T-cell-specific transcription factor GATA-3, GATA-binding factor 3, GATA binding factor 3, 1B11A8

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMCF-7 cells, HeLa cells, Jurkat cells, RAW 264.7 cells
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue
Positive IF/ICC detected inMCF-7 cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66400-1-Ig targets GATA3 in WB, IHC, IF/ICC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0174

Product name: Recombinant human GATA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 224-442 aa of BC003070

Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM

Predict reactive species
Full Name GATA binding protein 3
Calculated Molecular Weight 443 aa, 48 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC003070
Gene Symbol GATA3
Gene ID (NCBI) 2625
RRIDAB_2881774
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23771
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression.

Protocols

Product Specific Protocols
WB protocol for GATA3 antibody 66400-1-IgDownload protocol
IHC protocol for GATA3 antibody 66400-1-IgDownload protocol
IF protocol for GATA3 antibody 66400-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

Drug Resist Updat

GATA3 mediates doxorubicin resistance by inhibiting CYB5R2-catalyzed iron reduction in breast cancer cells

Authors - Zhen Zhu
humanWB

Cardiovasc Diabetol

BAG3 promotes proliferation and migration of arterial smooth muscle cells by regulating STAT3 phosphorylation in diabetic vascular remodeling

Authors - Xinyue Huang
pigWB

J Ethnopharmacol

Therapeutic effects and mechanisms study of Hanchuan Zupa Granule in a Guinea pig model of cough variant asthma.

Authors - Pengfei Li
mouseWB

Pharm Biol

Modified BuShenYiQi formula alleviates experimental allergic asthma in mice by negative regulation of type 2 innate lymphoid cells and CD4 + type 9 helper T cells and the VIP-VPAC2 signalling pathway

Authors - Muhua Huang
mouseWB

Int Arch Allergy Immunol

Lack of WDFY4 Aggravates Ovalbumin-Induced Asthma via Enhanced Th2 Cell Differentiation.

Authors - Yan Li
mouseWB,IF

Evid Based Complement Alternat Med

Astragali Radix-Coptis Rhizoma Herb Pair Attenuates Atherosclerosis in ApoE-/- Mice by Regulating the M1/M2 and Th1/Th2 Immune Balance and Activating the STAT6 Signaling Pathway.

Authors - Zhaoyu Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Renan (Verified Customer) (08-18-2022)

The fluorescence staining was noticeable, but the intensity was not so high, after using a tyramide signal amplification (TSA) protocol. The picture shows a lung lymphoid follicle, part of a 4-um FFPE tissue section. Heat-induced antigen retrieval was done with TRIS-EDTA buffer (pH 9.0) and GATA-3 was stained using a tyramide-conjugated Alexa Fluor 488 dye. CD3 is stained in yellow.

  • Applications: Immunohistochemistry, Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Lung lymphoid follicle
GATA3 Antibody Immunohistochemistry,Immunofluorescence validation (1:100 dilution) in Lung lymphoid follicle (Cat no:66400-1-Ig)
Loading...
||
New chat Able
正在加载,请稍候...