GATA3 Monoclonal antibody, PBS Only

GATA3 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA
Cat No. 66400-1-PBS
Clone No.1B11A8

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Trans-acting T-cell-specific transcription factor GATA-3, GATA-binding factor 3, GATA binding factor 3, 1B11A8

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66400-1-PBS targets GATA3 in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0174

Product name: Recombinant human GATA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 224-442 aa of BC003070

Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM

Predict reactive species
Full Name GATA binding protein 3
Calculated Molecular Weight 443 aa, 48 kDa
Observed Molecular Weight 50 kDa
GenBank Accession NumberBC003070
Gene Symbol GATA3
Gene ID (NCBI) 2625
RRIDAB_2881774
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23771
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

GATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression.

Loading...
||
New chat Able
正在加载,请稍候...