CoraLite® Plus 488-conjugated GATA3 Monoclonal antibody

GATA3 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-66400
Clone No.1B11A8

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

IF/ICC, FC (Intra)

Trans-acting T-cell-specific transcription factor GATA-3, GATA-binding factor 3, GATA binding factor 3, 1B11A8

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-66400 targets GATA3 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0174

Product name: Recombinant human GATA3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 224-442 aa of BC003070

Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM

Predict reactive species
Full Name GATA binding protein 3
Calculated Molecular Weight 443 aa, 48 kDa
GenBank Accession NumberBC003070
Gene Symbol GATA3
Gene ID (NCBI) 2625
RRIDAB_2883327
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP23771
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

GATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression.This antibody is conjugated with CL488, Ex/Em 488 nm/515 nm.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 GATA3 antibody CL488-66400Download protocol
IF protocol for CL Plus 488 GATA3 antibody CL488-66400Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...