GATA4 Monoclonal antibody

• 

  WB analysis of PC-3 using 68012-1-Ig

  PC-3 cells were subjected to SDS PAGE followed by western blot with 68012-1-Ig (GATA4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 68012-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 68012-1-Ig (GATA4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 68012-1-Ig

  HepG2 cells were subjected to SDS PAGE followed by western blot with 68012-1-Ig (GATA4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NCCIT using 68012-1-Ig

  NCCIT cells were subjected to SDS PAGE followed by western blot with 68012-1-Ig (GATA4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

GATA4 Monoclonal Antibody for WB, ELISA

Cat No. 68012-1-Ig

Clone No.2F5C6

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse

Applications

WB, ELISA

Synonyms

GATA binding factor 4, GATA binding protein 4, GATA4, Transcription factor GATA 4

---

Tested Applications

• Positive WB detected in: PC-3 cells, HEK-293 cells, HepG2 cells, NCCIT cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68012-1-Ig targets GATA4 in WB, ELISA applications and shows reactivity with Human, Mouse samples.

• Tested Reactivity: Human, Mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30392

  Product name: Recombinant human GATA4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 260-442 aa of BC101580

  Sequence: RLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKLHGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAAPSGSESLPPASGASSNSSNATTSSSEEMRPIKTEPGLSSHYGHSSSVSQTFSVSAMSGHGPSIHPVLSALKLSPQGYASPVSQSPQTSSKQDSWNSLVLADSHGDIITA

• Full Name: GATA binding protein 4
• Calculated Molecular Weight: 442 aa, 45 kDa
• Observed Molecular Weight: 44,45 kDa
• GenBank Accession Number: BC101580
• Gene Symbol: GATA4
• Gene ID (NCBI): 2626
• RRID: AB_2918759
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P43694
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GATA4 is a transcriptional activator. GATA4 binds to the consensus sequence 5'-AGATAG-3'. GATA4 acts as a transcriptional activator of ANF in cooperation with NKX2-5. Mutation of GATA4 will cause the atrial septal defect type 2 (ASD2).