GATAD2B Polyclonal antibody

• 

  WB analysis of A549 using 25679-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 25679-1-AP (GATAD2B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 25679-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 25679-1-AP (GATAD2B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 25679-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 25679-1-AP (GATAD2B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 25679-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 25679-1-AP (GATAD2B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 25679-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25679-1-AP (GATAD2B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 25679-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 25679-1-AP (GATAD2B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of A431 using 25679-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using GATAD2B antibody (25679-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

GATAD2B Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 25679-1-AP

Publications(3)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF/ICC, IP, ELISA

Synonyms

Transcriptional repressor p66-beta, P66beta, p66/p68, GATA zinc finger domain-containing protein 2B

---

Tested Applications

• Positive WB detected in: A549 cells, HEK-293 cells, HeLa cells, K-562 cells, MCF-7 cells, PC-3 cells
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 3 publications below
• IP: See 1 publications below

Product Information

25679-1-AP targets GATAD2B in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22615

  Product name: Recombinant human GATAD2B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-170 aa of BC069419

  Sequence: MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKMLALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSARRSEPERGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGIEERQQLIKQLR

• Full Name: GATA zinc finger domain containing 2B
• Observed Molecular Weight: 69 kDa
• GenBank Accession Number: BC069419
• Gene Symbol: GATAD2B
• Gene ID (NCBI): 57459
• RRID: AB_2880190
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXI9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Commun; Identification of proximal SUMO-dependent interactors using SUMO-ID.; Authors - Orhi Barroso-Gomila
human	WB	Nucleic Acids Res; CARM1 hypermethylates the NuRD chromatin remodeling complex to promote cell cycle gene expression and breast cancer development; Authors - Xue Chen
mouse	WB,IP	Cell Prolif; GATAD2B is required for pre-implantation embryonic development by regulating zygotic genome activation; Authors - Yuling Lin