GATC Polyclonal antibody

• 

  IP experiment of mouse liver using 23183-1-AP

  IP result of anti-GATC (IP:23183-1-AP, 3ug; Detection:23183-1-AP 1:500) with mouse liver tissue lysate 12500ug.

• 

  IHC staining of human liver using 23183-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23183-1-AP (GATC antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 23183-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23183-1-AP (GATC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human appendicitis using 23183-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 23183-1-AP (GATC antibody) at dilution of 1:400 (under 10x lens).

• 

  IHC staining of human appendicitis using 23183-1-AP

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 23183-1-AP (GATC antibody) at dilution of 1:400 (under 40x lens).

GATC Polyclonal Antibody for IP, IHC, ELISA

Cat No. 23183-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IP, IHC, ELISA

Synonyms

15E1.2, GATC, GatC like protein, Protein 15E1.2

---

Tested Applications

• Positive IP detected in: mouse liver tissue
• Positive IHC detected in: human liver tissue, human appendicitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23183-1-AP targets GATC in IP, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19713

  Product name: Recombinant human GATC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-136 aa of BC107145

  Sequence: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS

• Full Name: glutamyl-tRNA(Gln) amidotransferase, subunit C homolog (bacterial)
• Calculated Molecular Weight: 136 aa, 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC107145
• Gene Symbol: GATC
• Gene ID (NCBI): 283459
• RRID: AB_2879226
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O43716
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GATC encodes a subunit of the glutamyl-tRNA(Gln) amidotransferase protein complex (GatCAB), which plays a role in aminoacylation of mitochondrial glutaminyl mt-tRNA. The complex plays an role in mitochondrial translation and protein synthesis (PubMed: 30283131).