GBA Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GBA Polyclonal antibody (27972-1-AP)

GBA Polyclonal Antibody for WB, IHC, ELISA

Cat No. 27972-1-AP Copied!

Publications (5)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

GBA1, Acid beta-glucosidase, Beta-GC, Beta-glucocerebrosidase, Beta-glucosylceramidase 1

• 

  WB analysis using 27972-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27972-1-AP (GBA antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 27972-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 27972-1-AP (GBA antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 27972-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 27972-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 27972-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse kidney using 27972-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 27972-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 27972-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat liver using 27972-1-AP

  Immunohistochemical analysis of paraffin-embedded rat liver tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat pancreas using 27972-1-AP

  Immunohistochemical analysis of paraffin-embedded rat pancreas tissue slide using 27972-1-AP (GBA antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GBA in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: SH-SY5Y cells, HeLa cells
• Positive IHC detected in: mouse brain tissue, mouse kidney tissue, mouse liver tissue, rat pancreas tissue, human placenta tissue, rat liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27972-1-AP targets GBA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27388

  Product name: Recombinant human GBA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 75-305 aa of BC003356

  Sequence: TFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYFVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRDFIARDLGP

• Full Name: glucosidase, beta; acid (includes glucosylceramidase)
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60-65 kDa
• GenBank Accession Number: BC003356
• Gene Symbol: GBA
• Gene ID (NCBI): 2629
• RRID: AB_2881024
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P04062
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The GBA Polyclonal antibody (Cat# 27972-1-AP) has 5 citations published in Scientific Reports Total Environment, NPJ Parkinson's Disease, Molecular & Cellular Proteomics, Biology Direct, and F1000Research. These studies span research fields including axonal autophagy and synaptic toxicity, Parkinson's disease biomarker evaluation, lysosomal proteomics, renal lipidomic remodeling, and GCase antibody performance validation for western blot, immunoprecipitation, and immunofluorescence applications.

Automatically generated from the 5 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Sci Total Environ; Manganese disrupts the maturation and degradation of axonal autophagosome leading to hippocampal synaptic toxicity in mice via the activation of LRRK2 on phosphorylation of Rab10; Authors - Zhuo Ma
pig	WB	NPJ Parkinsons Dis; Evaluating Parkinson's disease biomarkers in substantia nigra following sublethal γ-radiation exposure in a large animal model.; Authors - Erin K Murphy
human	WB	Mol Cell Proteomics; Multi Cell Line Analysis of Lysosomal Proteomes Reveals Unique Features and Novel Lysosomal Proteins; Authors - Fatema Akter
mouse	WB,IF	Biol Direct; Dapagliflozin induces renal lipidomic remodeling and systemic metabolic improvement.; Authors - Anni Li
human	WB,IF	F1000Res; A guide to selecting high-performing antibodies for GCase (UniProt ID: P04062) for use in western blot, immunoprecipitation, and immunofluorescence.; Authors - Donovan Worrall ; KO Validated