GBA Polyclonal antibody

• 

  IHC staining of human breast cancer using 20622-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 20622-1-AP (GBA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 20622-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 20622-1-AP (GBA antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human brain using 20622-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 20622-1-AP (GBA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 20622-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 20622-1-AP (GBA antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of SH-SY5Y using 20622-1-AP

  Immunofluorescent analysis of (-20℃ Ethanol) fixed SH-SY5Y cells using 20622-1-AP (GBA antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

GBA Polyclonal Antibody for IHC, IF/ICC, ELISA

Cat No. 20622-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, IF/ICC, ELISA

Synonyms

GBA1LP, glucosylceramidase beta 1 like, pseudogene, GBAP1, GBAP, Beta-GC

---

Tested Applications

• Positive IHC detected in: human breast cancer tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20622-1-AP targets GBA in IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13981

  Product name: Recombinant human GBA protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-221 aa of BC000349

  Sequence: MCLQPLQEQKQWALDGAEYRTIQANCTGTGIGYNIIWVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTRLKTKGAGNGKGPLKGQPRDIYHQTWARYIVKFLDAYAEHKLQFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANGTHHNVRLLMLDDQRLLLPHWAKVVLTDPEAAKG

• Full Name: glucosidase, beta; acid, pseudogene
• Calculated Molecular Weight: 321 aa, 36 kDa
• GenBank Accession Number: BC000349
• Gene Symbol: GBA
• Gene ID (NCBI): 2630
• RRID: AB_10696317
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.