GBAS Polyclonal antibody

• 

  WB analysis using 18570-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18570-1-AP (GBAS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18570-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18570-1-AP (GBAS antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 18570-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 18570-1-AP (GBAS antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 18570-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18570-1-AP (GBAS Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 18570-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 18570-1-AP (GBAS Antibody) at dilution of 1:200 (under 40x lens).

GBAS Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18570-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GBAS, NIPSNAP2, Protein NipSnap homolog 2

---

Tested Applications

• Positive WB detected in: A549 cells, mouse brain tissue, HepG2 cells, rat brain tissue, T-47D cells
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18570-1-AP targets GBAS in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13405

  Product name: Recombinant human GBAS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-286 aa of BC030821

  Sequence: MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ

• Full Name: glioblastoma amplified sequence
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC030821
• Gene Symbol: GBAS
• Gene ID (NCBI): 2631
• RRID: AB_2878553
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75323
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.