GBE1 Polyclonal antibody

• 

  WB analysis using 20313-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20313-1-AP (GBE1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human skeletal muscle using 20313-1-AP

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 20313-1-AP (GBE1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of L02 using 20313-1-AP

  IP result of anti-GBE1 (IP:20313-1-AP, 4ug; Detection:20313-1-AP 1:2000) with L02 cells lysate 1360 ug.

• 

  IF Staining of HeLa using 20313-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GBE1 antibody (20313-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

GBE1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 20313-1-AP

Publications(11)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

GSD4, Glycogen-branching enzyme, GBE, EC:2.4.1.18, APBD

---

Tested Applications

• Positive WB detected in: L02 cells, human skeletal muscle tissue, mouse liver tissue, rat liver tissue
• Positive IP detected in: L02 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 11 publications below
• IF: See 1 publications below

Product Information

20313-1-AP targets GBE1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14154

  Product name: Recombinant human GBE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-302 aa of BC012098

  Sequence: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNM

• Full Name: glucan (1,4-alpha-), branching enzyme 1
• Calculated Molecular Weight: 702 aa, 80 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC012098
• Gene Symbol: GBE1
• Gene ID (NCBI): 2632
• RRID: AB_10697658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q04446
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GBE1 (glucan (1,4-alpha-), branching enzyme 1) is essential for the globular and branched structure of glycogen, increasing solubility by creating a hydrophilic surface and reducing intracellular osmotic pressure. It may serve as a potential therapeutic target for treating LUAD(PMID: 31221150). The full sequence can be further processed into a mature form of 75 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Am J Hum Genet; Loss of C2orf69 defines a fatal autoinflammatory syndrome in humans and zebrafish that evokes a glycogen storage-associated mitochondriopathy.; Authors - Hui Hui Wong ; KD Validated
human	WB	Int J Biol Sci; PYGL-mediated glucose metabolism reprogramming promotes EMT phenotype and metastasis of pancreatic cancer; Authors - Qian Ji
rat	WB	Carbohydr Polym; Liver fibrosis alters the molecular structures of hepatic glycogen; Authors - Yujun Wan
human	WB	iScience; MYCT1 alters the glycogen shunt by regulating selective translation of RACK1-mediated enzymes.; Authors - Dong-Xue Ding
mouse	WB	J Proteome Res; Global Phosphoproteomic Analysis Reveals Significant Metabolic Reprogramming in the Termination of Liver Regeneration in Mice.; Authors - Jingzi Zhang
rat	WB	PLoS One; A novel genetic model provides a unique perspective on the relationship between postexercise glycogen concentration and increases in the abundance of key metabolic proteins after acute exercise; Authors - Seong Eun Kwak

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Sarah (Verified Customer) (08-27-2025)

Antibody works well in preliminary experiments. I have not used this antibody extensively.

• Applications: Western Blot
• Cell Tissue Type: RPMI8226

FH

Sarah (Verified Customer) (08-07-2025)

Antibody works well with 1:1000 dilution and HRP secondary antibody.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: RPMI8226