Tested Applications
| Positive WB detected in | L02 cells, human skeletal muscle tissue, mouse liver tissue, rat liver tissue |
| Positive IP detected in | L02 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20313-1-AP targets GBE1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14154 Product name: Recombinant human GBE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC012098 Sequence: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNM Predict reactive species |
| Full Name | glucan (1,4-alpha-), branching enzyme 1 |
| Calculated Molecular Weight | 702 aa, 80 kDa |
| Observed Molecular Weight | 72 kDa |
| GenBank Accession Number | BC012098 |
| Gene Symbol | GBE1 |
| Gene ID (NCBI) | 2632 |
| RRID | AB_10697658 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q04446 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GBE1 (glucan (1,4-alpha-), branching enzyme 1) is essential for the globular and branched structure of glycogen, increasing solubility by creating a hydrophilic surface and reducing intracellular osmotic pressure. It may serve as a potential therapeutic target for treating LUAD(PMID: 31221150). The full sequence can be further processed into a mature form of 75 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GBE1 antibody 20313-1-AP | Download protocol |
| IP protocol for GBE1 antibody 20313-1-AP | Download protocol |
| WB protocol for GBE1 antibody 20313-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GBE1 antibody (Cat# 20313-1-AP) has 14 citations published in journals including Nucleic Acids Research, Carbohydrate Polymers, Cell & Molecular Biology Letters, International Journal of Biological Sciences, American Journal of Human Genetics, Biochemical Pharmacology, Cell & Molecular Life Sciences, Molecular & Cellular Biochemistry, iScience, Journal of Proteome Research, Archives of Biochemistry & Biophysics, Brain Research, PLoS ONE, and Molecular Genetics & Metabolism Reports. Research fields span glycogen metabolism, pancreatic cancer, liver fibrosis, leukemia, endometriosis, pulmonary hypertension, Parkinson's disease, and glycogen storage disorders.
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res Splice-modulating antisense oligonucleotides targeting a pathogenic intronic variant in adult polyglucosan body disease correct mis-splicing and restore enzyme activity in patient cells | ||
Cell Mol Biol Lett WTAP/IGF2BP3-mediated GBE1 expression accelerates the proliferation and enhances stemness in pancreatic cancer cells via upregulating c-Myc | ||
Int J Biol Sci PYGL-mediated glucose metabolism reprogramming promotes EMT phenotype and metastasis of pancreatic cancer | ||
Am J Hum Genet Loss of C2orf69 defines a fatal autoinflammatory syndrome in humans and zebrafish that evokes a glycogen storage-associated mitochondriopathy.
| ||
Cell Mol Life Sci SIRT7 drives energy metabolic shifts in endometriosis via interaction with TUFM and Rhoa/Rock/Akt pathway activation. |
Reviews
What customers say
Both reviewers rated this antibody 5 stars for Western Blot on RPMI8226 cells. One user reported it works well at a 1:1000 dilution paired with an HRP secondary antibody. The other noted it performed well in preliminary experiments, though they had not yet used it extensively. Overall, users found the antibody reliable and effective for WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Sarah (Verified Customer) (08-27-2025) | Antibody works well in preliminary experiments. I have not used this antibody extensively.
|
Sarah (Verified Customer) (08-07-2025) | Antibody works well with 1:1000 dilution and HRP secondary antibody.
|
