GBGT1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GBGT1 Polyclonal antibody (32983-1-AP)

• 

  WB analysis using 32983-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32983-1-AP (GBGT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

GBGT1 Polyclonal Antibody for WB, ELISA

Cat No. 32983-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Forssman glycolipid synthase-like protein, Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1, UNQ2513/PRO6002

---

Tested Applications

• Positive WB detected in: Jurkat cells, OVCAR-3 cells, SKOV-3 cells, mouse ovary tissue, rat ovary tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32983-1-AP targets GBGT1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38506

  Product name: Recombinant human GBGT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 185-347 aa of NM_021996.5

  Sequence: ETISQHIAKRAHREVDYLFCLDVDMVFRNPWGPETLGDLVAAIHPSYYAVPRQQFPYERRRVSTAFVADSEGDFYYGGAVFGGQVARVYEFTRGCHMAILADKANGIMAAWREESHLNRHFISNKPSKVLSPEYLWDDRKPQPPSLKLIRFSTLDKDISCLRS

• Full Name: globoside alpha-1,3-N-acetylgalactosaminyltransferase 1
• Calculated Molecular Weight: 40kDa，347aa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_021996.5
• Gene Symbol: GBGT1
• Gene ID (NCBI): 26301
• RRID: AB_3742812
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8N5D6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GBGT1 (Globoside alpha-1,3-N-acetylgalactosaminyltransferase 1) gene is located on chromosome 9 (9q34) and comprises 347 amino acids. GBGT1 is the most differentially expressed glycogene involved in the biosynthesis of Fs antigen and GBGT1 is differentially methylated and associated with inflammatory bowel disease (PMID: 25294702). GBGT1 mRNA expression has been observed in a variety of human tissues being highest in placenta and ovary (PMID: 31933576).