Home
Products
Primary Antibodies
GBP3 Polyclonal antibody, PBS Only (30719-1-PBS)

Filter: AllWBIHC

WB analysis using 30719-1-AP (same clone as 30719-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 30719-1-AP (GBP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30719-1-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 30719-1-AP (same clone as 30719-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 30719-1-AP (GBP3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30719-1-PBS in a different storage buffer formulation.
IHC staining of mouse cerebellum using 30719-1-AP (same clone as 30719-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 30719-1-AP (GBP3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30719-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 30719-1-AP (same clone as 30719-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 30719-1-AP (GBP3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30719-1-PBS in a different storage buffer formulation.
IHC staining of mouse lung using 30719-1-AP (same clone as 30719-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 30719-1-AP (GBP3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30719-1-PBS in a different storage buffer formulation.

GBP3 Polyclonal antibody, PBS Only

Name: GBP3 Polyclonal antibody, PBS Only
Brand: Proteintech
SKU: 30719-1-PBS

GBP3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30719-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS, Azide, Glycerol

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

30719-1-PBS targets GBP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag33889 Product name: Recombinant human GBP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 535-595 aa of BC140837 Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI* Predict reactive species
Full Name	guanylate binding protein 3
Observed Molecular Weight	68 kDa
GenBank Accession Number	BC140837
Gene Symbol	GBP3
Gene ID (NCBI)	2635
RRID	AB_3086400
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9H0R5
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Guanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa.