Product Information
30719-1-PBS targets GBP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33889 Product name: Recombinant human GBP3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 535-595 aa of BC140837 Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI* Predict reactive species |
| Full Name | guanylate binding protein 3 |
| Observed Molecular Weight | 68 kDa |
| GenBank Accession Number | BC140837 |
| Gene Symbol | GBP3 |
| Gene ID (NCBI) | 2635 |
| RRID | AB_3086400 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0R5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Guanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa.









