GBP3 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83534-1-RR (same clone as 83534-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83534-1-RR (GBP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83534-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HT-29 using 83534-1-RR (same clone as 83534-1-PBS)

  1x10^6 HT-29 cells were intracellularly stained with 0.25 ug Gbp3 Recombinant Antibody (83534-1-RR, Clone:230178D8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 83534-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83534-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83534-1-RR against Human GBP3 were performed. The affinity constant is below 1 pM.

GBP3 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83534-1-PBS

Clone No.230178D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

Synonyms

230178D8, EC:3.6.5.-, GBP 3, GBP-3, GTP binding protein 3

---

Product Information

83534-1-PBS targets GBP3 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33889

  Product name: Recombinant human GBP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 535-595 aa of BC140837

  Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI*

• Full Name: guanylate binding protein 3
• GenBank Accession Number: BC140837
• Gene Symbol: GBP3
• Gene ID (NCBI): 2635
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9H0R5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.