GBP3 Recombinant monoclonal antibody

• 

  WB analysis using 83534-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83534-1-RR (GBP3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of HT-29 using 83534-1-RR

  1x10^6 HT-29 cells were intracellularly stained with 0.25 ug Gbp3 Recombinant Antibody (83534-1-RR, Clone:230178D8) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• 

  Affinity and Kinetic Characterization of 83534-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83534-1-RR against Human GBP3 were performed. The affinity constant is below 1 pM.

GBP3 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83534-1-RR

Clone No.230178D8

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, FC (Intra), ELISA

Synonyms

230178D8, EC:3.6.5.-, GBP 3, GBP-3, GTP binding protein 3

---

Tested Applications

• Positive WB detected in: K-562 cells, HeLa cells, Jurkat cells, HUVEC cells, U-251 cells
• Positive FC (Intra) detected in: HT-29 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

83534-1-RR targets GBP3 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: monkey
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33889

  Product name: Recombinant human GBP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 535-595 aa of BC140837

  Sequence: RERAQLLEEQEKTLTSKLQEQARVLKERCQGESTQLQNEIQKLQKTLKKKTKRYMSHKLKI*

• Full Name: guanylate binding protein 3
• Observed Molecular Weight: 62 kDa, 68 kDa
• GenBank Accession Number: BC140837
• Gene Symbol: GBP3
• Gene ID (NCBI): 2635
• RRID: AB_3671159
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q9H0R5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Guanylate-binding protein 3 (GBP3) is involved in the proliferation of glioma cells through regulating SQSTM1-ERK1/2 pathway. GBP3 has 2 isoforms, one is 595 amino acids long at 68 kDa and the other is at nearly 62 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
monkey	WB	J Virol; MA104 cell line is permissive for human bocavirus 1 infection; Authors - Jielin Tang