GBX2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GBX2 Polyclonal antibody, PBS Only (21639-1-PBS)

• Featured Product
• KD/KO Validated

GBX2 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 21639-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, IP, ELISA

Synonyms

Gastrulation and brain-specific homeobox protein 2, Homeobox protein GBX-2

• 

  WB analysis of HeLa using 21639-1-AP (same clone as 21639-1-PBS)

  WB result of GBX2 antibody (21639-1-AP; 1:400; incubated at room temperature for 1.5 hours) with sh-Control and sh-GBX2 transfected HeLa cells. This data was developed using the same antibody clone with 21639-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse stomach using 21639-1-AP (same clone as 21639-1-PBS)

  mouse stomach tissue were subjected to SDS PAGE followed by western blot with 21639-1-AP (GBX2 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21639-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 21639-1-AP (same clone as 21639-1-PBS)

  IP result of anti-GBX2 (IP:21639-1-AP, 4ug; Detection:21639-1-AP 1:300) with HeLa cells lysate 3000ug. This data was developed using the same antibody clone with 21639-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 21639-1-AP (same clone as 21639-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GBX2 antibody (21639-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 21639-1-PBS in a different storage buffer formulation.

---

Product Information

21639-1-PBS targets GBX2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16288

  Product name: Recombinant human GBX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 65-248 aa of BC137448

  Sequence: LPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNR

• Full Name: gastrulation brain homeobox 2
• Calculated Molecular Weight: 348 aa, 37 kDa
• Observed Molecular Weight: 33-37 kDa
• GenBank Accession Number: BC137448
• Gene Symbol: GBX2
• Gene ID (NCBI): 2637
• RRID: AB_2878896
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52951
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Homeobox protein GBX-2 (GBX-2) is a homeobox gene essential for normal development of the midbrain and the anterior hindbrain. It mainly expressed in the brain, and located in nucleoplasm. It is presumably a transcription factor that is likely to regulate the expression of genes involved in establishing early A/P pattern in the neural plate (PMID: 9247335).