Use Able AI chat for product recommendations
  • KD/KO Validated

GBX2 Monoclonal antibody

GBX2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 61029-1-Ig
Clone No.4F3E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Gastrulation and brain-specific homeobox protein 2, Homeobox protein GBX-2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNCI-H1299 cells, C2C12 cells, PC-3 cells, HCT 116 cells, A172 cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

61029-1-Ig targets GBX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17109

Product name: Recombinant human GBX2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 65-248 aa of BC137448

Sequence: LPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNR

Predict reactive species
Full Name gastrulation brain homeobox 2
Calculated Molecular Weight 348 aa, 37 kDa
Observed Molecular Weight37 kDa
GenBank Accession NumberBC137448
Gene Symbol GBX2
Gene ID (NCBI) 2637
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP52951
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gastrulation Brain Homeobox 2 (GBX2) is a transcription factor belonging to the homeobox gene family, which plays a critical role in embryonic development, particularly in brain patterning and neural differentiation. It is highly conserved across vertebrates and is essential for the proper formation of the midbrain-hindbrain boundary and the development of the cerebellum. GBX2 is expressed in specific regions of the developing central nervous system and regulates downstream target genes involved in cell fate determination and tissue morphogenesis. Dysregulation or mutations in GBX2 have been associated with developmental disorders and may contribute to tumorigenesis in certain cancers. (PMID: 11063941; PMID: 31758726)

Protocols

Product Specific Protocols
IF protocol for GBX2 antibody 61029-1-IgDownload protocol
IHC protocol for GBX2 antibody 61029-1-IgDownload protocol
WB protocol for GBX2 antibody 61029-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...