GBX2 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• GBX2 Monoclonal antibody (61029-1-Ig)

• 

  WB analysis using 61029-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 61029-1-Ig (GBX2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 61029-1-Ig

  WB result of GBX2 antibody (61029-1-Ig; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-GBX2 transfected PC-3 cells.

• 

  WB analysis of C2C12 using 61029-1-Ig

  C2C12 cells were subjected to SDS PAGE followed by western blot with 61029-1-Ig (GBX2 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse brain using 61029-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 61029-1-Ig (GBX2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 61029-1-Ig

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 61029-1-Ig (GBX2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 61029-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using GBX2 antibody (61029-1-Ig, Clone: 4F3E4 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-phalloidin (red).

• KD/KO Validated

GBX2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 61029-1-Ig

Clone No.4F3E4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Gastrulation and brain-specific homeobox protein 2, Homeobox protein GBX-2

---

Tested Applications

• Positive WB detected in: NCI-H1299 cells, C2C12 cells, PC-3 cells, HCT 116 cells, A172 cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

61029-1-Ig targets GBX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17109

  Product name: Recombinant human GBX2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 65-248 aa of BC137448

  Sequence: LPQAALQPALPPAHPHHQIPSLPTGFCSSLAQGMALTSTLMATLPGGFSASPQHQEAAAARKFAPQPLPGGGNFDKAEALQADAEDGKGFLAKEGSLLAFSAAETVQASLVGAVRGQGKDESKVEDDPKGKEESFSLESDVDYSSDDNLTGQAAHKEEDPGHALEETPPSSGAAGSTTSTGKNR

• Full Name: gastrulation brain homeobox 2
• Calculated Molecular Weight: 348 aa, 37 kDa
• Observed Molecular Weight: 37 kDa
• GenBank Accession Number: BC137448
• Gene Symbol: GBX2
• Gene ID (NCBI): 2637
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P52951
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gastrulation Brain Homeobox 2 (GBX2) is a transcription factor belonging to the homeobox gene family, which plays a critical role in embryonic development, particularly in brain patterning and neural differentiation. It is highly conserved across vertebrates and is essential for the proper formation of the midbrain-hindbrain boundary and the development of the cerebellum. GBX2 is expressed in specific regions of the developing central nervous system and regulates downstream target genes involved in cell fate determination and tissue morphogenesis. Dysregulation or mutations in GBX2 have been associated with developmental disorders and may contribute to tumorigenesis in certain cancers. (PMID: 11063941; PMID: 31758726)