GCAP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• GCAP1 Polyclonal antibody, PBS Only (12944-1-PBS)

• 

  WB analysis of Y79 using 12944-1-AP (same clone as 12944-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 12944-1-AP (GCAP1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12944-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 12944-1-AP (same clone as 12944-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 12944-1-AP (GCAP1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12944-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 12944-1-AP (same clone as 12944-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 12944-1-AP (GCAP1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12944-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Y79 using 12944-1-AP (same clone as 12944-1-PBS)

  Y79 cells were subjected to SDS PAGE followed by western blot with 12944-1-AP (GCAP1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12944-1-PBS in a different storage buffer formulation.

GCAP1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12944-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12944-1-PBS targets GCAP1 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4017

  Product name: Recombinant human GUCA1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC031663

  Sequence: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG

• Full Name: guanylate cyclase activator 1A (retina)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23-24 kDa
• GenBank Accession Number: BC031663
• Gene Symbol: GUCA1A
• Gene ID (NCBI): 2978
• RRID: AB_10638474
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P43080
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.