GCC1 Polyclonal antibody

• 

  WB analysis using 16271-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16271-1-AP (GCC1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse ovary using 16271-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 16271-1-AP (GCC1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 16271-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16271-1-AP (GCC1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver using 16271-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16271-1-AP (GCC1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IF Staining of A431 using 16271-1-AP

  Immunofluorescent analysis of A431 cells using 16271-1-AP (GCC1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

GCC1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16271-1-AP

Publications(7)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

GCC1, GCC1P, GCC88, Golgi coiled coil protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse ovary tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IF: See 3 publications below

Product Information

16271-1-AP targets GCC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9339

  Product name: Recombinant human GCC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 424-775 aa of BC014100

  Sequence: ESSLDVNVLKDKMEKLKRLLQVAARKSQVTLDVEKLCDLEIMPSSEAADGEKATALYYQQELKQLKEEFERYKMRAQVVLKSKNTKDGNLGKELEAAQEQLAELKEKYISLRLSCEELEHQHQQEADDWKQELARLQQLHRQELERCQLDFRDRTLKLEEELHKQRDRALAVLTEKDLELEQLRSVALASGLPGRRSPVGGGGPGDPADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPTSASWWPSGKR

• Full Name: GRIP and coiled-coil domain containing 1
• Calculated Molecular Weight: 775 aa, 88 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC014100
• Gene Symbol: GCC1
• Gene ID (NCBI): 79571
• RRID: AB_2107197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CN9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GCC1 (Golgi coiled coil protein 1), also known as GCC1P or GCC88, is a protein probably involved in maintaining Golgi structure. The MW of this protein is 105 kDa, and Catalog#16271-1-AP specially recognises the 105 kDa protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; GRASP55 regulates the unconventional secretion and aggregation of mutant huntingtin.; Authors - Erpan Ahat
human	WB	Mol Biol Cell; Hydrogen peroxide induces Arl1 degradation and impairs Golgi-mediated trafficking.; Authors - Stephen C Ireland
human	WB	Mol Biol Cell; DjA1 maintains Golgi integrity via interaction with GRASP65.; Authors - Jie Li
human	WB	bioRxiv; SARS-CoV-2 triggers Golgi fragmentation via down-regulation of GRASP55 to facilitate viral trafficking.; Authors - Jianchao Zhang
human	WB,IF	Methods Mol Biol; Immunofluorescence Microscopy of the Mammalian Golgi Apparatus; Authors - Maryam Arab
	WB,IF	Methods Mol Biol; Common Markers and Small Molecule Inhibitors in Golgi Studies; Authors - Sarah Bui

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Boyan (Verified Customer) (04-28-2023)

clean band around the expected size

• Applications: Western Blot

FH

Jie (Verified Customer) (09-17-2020)

Works well for WB and IF with HeLa and CHO cells

• Applications: Western Blot, Immunofluorescence
• Cell Tissue Type: HeLa, CHO