GCC1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GCC1 Polyclonal antibody (16271-1-AP)

GCC1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16271-1-AP Copied!

Publications (7)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Golgi coiled-coil protein 1, GRIP and coiled-coil domain-containing protein 1

• 

  WB analysis using 16271-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16271-1-AP (GCC1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse ovary using 16271-1-AP

  mouse ovary tissue were subjected to SDS PAGE followed by western blot with 16271-1-AP (GCC1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16271-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16271-1-AP (GCC1 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 16271-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 16271-1-AP (GCC1 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 16271-1-AP

  Immunofluorescent analysis of A431 cells using 16271-1-AP (GCC1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GCC1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, mouse ovary tissue, HeLa cells, HEK-293 cells, HepG2 cells, rat ovary tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16271-1-AP targets GCC1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9339

  Product name: Recombinant human GCC1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 424-775 aa of BC014100

  Sequence: ESSLDVNVLKDKMEKLKRLLQVAARKSQVTLDVEKLCDLEIMPSSEAADGEKATALYYQQELKQLKEEFERYKMRAQVVLKSKNTKDGNLGKELEAAQEQLAELKEKYISLRLSCEELEHQHQQEADDWKQELARLQQLHRQELERCQLDFRDRTLKLEEELHKQRDRALAVLTEKDLELEQLRSVALASGLPGRRSPVGGGGPGDPADTSSSDSLTQALQLAAANEPTFFLYAEQLARKEVEITSLRKQKHRLEVEVHQLQDRLLEEGERHREEVAALQSHIEKNIRDQSREGANLEYLKNIIYRFLTLPDSLGRQQTLTAILTILHFSPEEKQVIMRLPTSASWWPSGKR

• Full Name: GRIP and coiled-coil domain containing 1
• Calculated Molecular Weight: 775 aa, 88 kDa
• Observed Molecular Weight: 105 kDa
• GenBank Accession Number: BC014100
• Gene Symbol: GCC1
• Gene ID (NCBI): 79571
• RRID: AB_2107197
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96CN9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GCC1 (Golgi coiled coil protein 1), also known as GCC1P or GCC88, is a protein probably involved in maintaining Golgi structure. The MW of this protein is 105 kDa, and Catalog#16271-1-AP specially recognises the 105 kDa protein.

Publications

What published studies show

The GCC1 Polyclonal antibody (Cat# 16271-1-AP) has 7 citations published in J Biol Chem, Mol Biol Cell, Methods Mol Biol, Biophys Rep, and bioRxiv. Research fields include Golgi structure and integrity, Golgi-mediated trafficking, unconventional protein secretion, SARS-CoV-2 viral trafficking, and Golgi fragmentation. Applications cited are primarily WB and IF in human samples.

Automatically generated from the 7 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; GRASP55 regulates the unconventional secretion and aggregation of mutant huntingtin.; Authors - Erpan Ahat
human	WB	Mol Biol Cell; Hydrogen peroxide induces Arl1 degradation and impairs Golgi-mediated trafficking.; Authors - Stephen C Ireland
human	WB	Mol Biol Cell; DjA1 maintains Golgi integrity via interaction with GRASP65.; Authors - Jie Li
	WB,IF	Methods Mol Biol; Common Markers and Small Molecule Inhibitors in Golgi Studies; Authors - Sarah Bui
human	WB,IF	Methods Mol Biol; Immunofluorescence Microscopy of the Mammalian Golgi Apparatus; Authors - Maryam Arab
human	WB	bioRxiv; SARS-CoV-2 triggers Golgi fragmentation via down-regulation of GRASP55 to facilitate viral trafficking.; Authors - Jianchao Zhang

Reviews

5.0 out of 5

2 verified customer reviews

What customers say

Both reviewers gave this antibody a perfect 5-star rating. One user reported a clean band at the expected molecular weight in Western Blot. The other confirmed reliable performance in both Western Blot and Immunofluorescence using HeLa and CHO cells. Overall, customers find this antibody to produce clear, specific results across multiple applications with no notable issues.

Automatically generated from the 2 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Boyan (Verified Customer) (04-28-2023)

clean band around the expected size

• Applications: Western Blot

Jie (Verified Customer) (09-17-2020)

Works well for WB and IF with HeLa and CHO cells

• Applications: Western Blot, Immunofluorescence
• Cell Tissue Type: HeLa, CHO