GCET2 Polyclonal antibody

• 

  WB analysis of Raji using 13447-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 13447-1-AP (GCET2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of Raji using 13447-1-AP

  Immunofluorescent analysis of (4% PFA) fixed Raji cells using GCET2 antibody (13447-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

GCET2 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 13447-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Germinal center-associated signaling and motility protein, Germinal center-associated lymphoma protein, Germinal center B-cell-expressed transcript 2 protein, GCSAM, GCAT2

---

Tested Applications

• Positive WB detected in: Raji cells
• Positive IF/ICC detected in: Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13447-1-AP targets GCET2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4280

  Product name: Recombinant human GCET2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-178 aa of BC030506

  Sequence: MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL

• Full Name: germinal center expressed transcript 2
• Calculated Molecular Weight: 178 aa, 21 kDa
• Observed Molecular Weight: 25 kDa
• GenBank Accession Number: BC030506
• Gene Symbol: GCET2
• Gene ID (NCBI): 257144
• RRID: AB_2877949
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N6F7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GCET2, also named HGAL, is a newly gene that has been shown to be a useful marker for germinal centre (GC) B cells and GC B-cell derived malignancies, including follicular lymphomas and germinal centre B cell-like diffuse large B-cell lymphomas (GCB-DLBCLs), and is a useful prognosticator for DLBCLs. GCET2 may be an adaptor protein in GC B cells that transduces signals from GC B-cell membrane to the cytosol via its association with GRB2.