GCN1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GCN1 Polyclonal antibody (30993-1-AP)

• 

  WB analysis using 30993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30993-1-AP (GCN1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of U2OS using 30993-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U2OS cells using GCN1 antibody (30993-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

GCN1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30993-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

GCN1L1, GCN1L, HsGCN1, KIAA0219, PRIC295

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse testis tissue
• Positive IF/ICC detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30993-1-AP targets GCN1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34311

  Product name: Recombinant human GCN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 624-745 aa of BC153881

  Sequence: EALVTDAGEVTEAGKAYVPPRVLQEALCVISGVPGLKGDVTDTEQLAQEMLIISHHPSLVAVQSGLWPALLARMKIDPEAFITRHLDQIIPRMTTQSPLNQSSMNAMGSLSVLSPDRVLPQLIST

• Full Name: GCN1 general control of amino-acid synthesis 1-like 1 (yeast)
• Calculated Molecular Weight: 293 kDa
• Observed Molecular Weight: 250 kDa
• GenBank Accession Number: BC153881
• Gene Symbol: GCN1L1
• Gene ID (NCBI): 10985
• RRID: AB_3742385
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q92616
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GCN1 (General Control Nonderepressible 1), also designated as GCN1L1, is a member of the GCN1 protein family. Its core function is to serve as a central regulator of the integrated stress response (ISR), acting as a key molecular adaptor that facilitates the activation of GCN2 kinase. Under stress conditions such as amino acid starvation, GCN1 binds uncharged tRNA through its C-terminal domain while concurrently binding and activating GCN2 via its N-terminal domain. This leads to the phosphorylation of eIF2α, thereby initiating the ISR to modulate translation and gene expression. Furthermore, GCN1 participates in ribosome-associated quality control (RQC). In coordination with the RQT complex, it mediates the ubiquitination and subsequent degradation of aberrant nascent polypeptide chains on stalled ribosomes, thus preserving protein homeostasis.