GDNF Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GDNF Polyclonal antibody (26179-1-AP)

GDNF Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 26179-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ATF, ATF1, ATF2, GDNF, HFB1 GDNF, hGDNF

• 

  WB analysis using 26179-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26179-1-AP (GDNF antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 26179-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26179-1-AP (GDNF antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 26179-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 26179-1-AP (GDNF antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of SH-SY5Y using 26179-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed SH-SY5Y cells using GDNF antibody (26179-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for GDNF in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: DU 145 cells, HEK-293 cells, PC-3 cells, U-251 cells, U-87 MG cells
• Positive IHC detected in: mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26179-1-AP targets GDNF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24068

  Product name: Recombinant human GDNF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 78-211 aa of BC069369

  Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

• Full Name: glial cell derived neurotrophic factor
• Calculated Molecular Weight: 211 aa, 24 kDa
• Observed Molecular Weight: 32-40 kDa
• GenBank Accession Number: BC069369
• Gene Symbol: GDNF
• Gene ID (NCBI): 2668
• RRID: AB_3085846
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P39905
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Glial-derived neurotrophic factor (GDNF) is a member of the transforming growth factor (TGF)-α family and exhibits potent neuroprotective activity. GDNF is a potent promoter of neuronal survival in the CNS and peripheral nervous system (PNS). It has a relatively high speciicity for dopaminergic neurons and thus become an efective treatment for Parkinson's diseases (PD), with clinical trials currently in progress. Protein dimers of GDNF have a reported molecular weight of 32-40 kDa(PMID: 17982417, PMID: 23251488, PMID: 11429269).

Publications

What published studies show

The GDNF Polyclonal antibody (Cat# 26179-1-AP) has 8 citations published in Cancer Letters, Journal of Translational Medicine, Cell and Molecular Life Sciences, Comprehensive Physiology, International Immunopharmacology, Tissue & Cell, Experimental Eye Research, and Alpha Psychiatry. Research fields span pancreatic cancer, Parkinson's disease, reproductive biology, osteoporosis, spinal cord injury, diabetic retinopathy, and schizophrenia.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Cancer Lett; NEAT1 Promotes the Perineural Invasion of Pancreatic Cancer via the E2F1/GDNF Axis; Authors - Jingtao Gu
mouse	WB	J Transl Med; Intranasally administered muse cells attenuate neurodegeneration in Parkinson's disease.; Authors - Zhe Lu
human	WB,IF	Cell Mol Life Sci; Micro-proteomics reveals distinct protein profiles and SPARC/FGF2/CDH1 regulation of human Sertoli cells between Sertoli cell-only syndrome and normal men; Authors - Li Du
mouse	IHC,IF	Compr Physiol; GDNF Maintains Mitochondrial Homeostasis and Inhibits Ferroptosis to Improve Osteogenic Function in Osteoporosis.; Authors - Yafei Zhu
mouse	WB	Int Immunopharmacol; Lycium ruthenicum Murray anthocyanins alleviate neuroinflammation in MPTP-induced Parkinson's disease by modulating gut microbiota and tryptophan metabolism.; Authors - HanQing Guo
mouse	WB	Tissue Cell; Dental pulp stem cell-derived exosomes promote axonal repair in spinal cord injury by suppressing neuroinflammation and apoptosis.; Authors - Feng Li