GDNF Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GDNF Recombinant monoclonal antibody, PBS Only (83087-2-PBS)

• 

  WB analysis of mouse brain using 83087-2-RR (same clone as 83087-2-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 83087-2-RR (GDNF antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83087-2-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83087-2-RR

  Biolayer interferometry (BLl) kinetic assays of 83087-2-RR against Human GDNF were performed. The affinity constant is below 1 pM.

GDNF Uni-rAb^® Recombinant Antibody for ELISA, WB

Cat No. 83087-2-PBS

Clone No.230358G6

Host / Isotype

Rabbit / IgG

Reactivity

mouse, human

Applications

ELISA, WB

Synonyms

Glial cell line-derived neurotrophic factor, ATF2, ATF1, ATF, Astrocyte-derived trophic factor

---

Product Information

83087-2-PBS targets GDNF in ELISA, WB applications and shows reactivity with mouse, human samples.

• Tested Reactivity: mouse, human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24068

  Product name: Recombinant human GDNF protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 78-211 aa of BC069369

  Sequence: SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

• Full Name: glial cell derived neurotrophic factor
• Calculated Molecular Weight: 211 aa, 24 kDa
• GenBank Accession Number: BC069369
• Gene Symbol: GDNF
• Gene ID (NCBI): 2668
• RRID: AB_3670803
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P39905
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Glial-derived neurotrophic factor (GDNF) is a member of the transforming growth factor (TGF)-α family and exhibits potent neuroprotective activity. GDNF is a potent promoter of neuronal survival in the CNS and peripheral nervous system (PNS). It has a relatively high speciicity for dopaminergic neurons and thus become an efective treatment for Parkinson's diseases (PD), with clinical trials currently in progress.