GDPD3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GDPD3 Polyclonal antibody (20390-1-AP)

• 

  IHC staining of mouse bladder using 20390-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 20390-1-AP (GDPD3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse bladder using 20390-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 20390-1-AP (GDPD3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GDPD3 Polyclonal Antibody for IHC, ELISA

Cat No. 20390-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, ELISA

Synonyms

GDE7, Glycerophosphodiester phosphodiesterase 7, Glycerophosphodiester phosphodiesterase domain-containing protein 3, Lysophospholipase D GDPD3

---

Tested Applications

• Positive IHC detected in: mouse bladder tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20390-1-AP targets GDPD3 in IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14230

  Product name: Recombinant human GDPD3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-260 aa of BC002714

  Sequence: MENSMAQRSDLLELDCQLTRDRVVVVSHDENLCRQSGLNRDVGSLDFEDLPLYKEKLEVYFSPGHFAHGSDRRMVRLEDLFQRFPRTPMSVEIKGKNEELIREIAGLVRRYDRNEITIWASEKSSVMKKCKAANPEMPLSFTISRGFWVLLSYYLGLLPFIPIPEKFFFCFLPNIINRTYFPFSCSCLNQLLAVVSKWLIMRKSLIRHLEERGVQVVFWCLNEESDFEAAFSVGATGVITDYPTALRHYLDNHGPAARTS

• Full Name: glycerophosphodiester phosphodiesterase domain containing 3
• Calculated Molecular Weight: 318 aa, 37 kDa
• GenBank Accession Number: BC002714
• Gene Symbol: GDPD3
• Gene ID (NCBI): 79153
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q7L5L3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GDPD3 (glycerophosphodiester phosphodiesterase domain-containing 3), also termed GDE7, encodes a multi-pass membrane protein with lysophospholipase D activity. It hydrolyzes lysophospholipids to generate lysophosphatidic acid (LPA), a key lipid mediator involved in glycerol phosphate pathway-mediated triacylglycerol synthesis and hepatic steatosis. (PMID: 32430316)