GEMIN7 Polyclonal antibody

• 

  WB analysis using 10625-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10625-1-AP (GEMIN7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 10625-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 10625-1-AP (GEMIN7 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

GEMIN7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 10625-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Gem-associated protein 7, Gemin 7, Gemin-7, SIP3

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells，K-562 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10625-1-AP targets GEMIN7 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0976

  Product name: Recombinant human GEMIN7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC007793

  Sequence: MQTPVNIPVPVLRLPRGPDGFSRGFAPDGRRAPLRPEVPEIQECPIAQESLESQEQRARAALRERYLRSLLAMVGHQVSFTLHEGVRVAAHFGATDLDVANFYVSQLQTPIGVQAEALLRCSDIISYTFKP

• Full Name: gem (nuclear organelle) associated protein 7
• Calculated Molecular Weight: 15 kDa
• Observed Molecular Weight: 15 kDa
• GenBank Accession Number: BC007793
• Gene Symbol: GEMIN7
• Gene ID (NCBI): 79760
• RRID: AB_2111841
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H840
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.