GFI1 Polyclonal antibody

• 

  WB analysis of K-562 using 14198-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 14198-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse thymus using 14198-1-AP

  mouse thymus tissue were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 14198-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 14198-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 14198-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HL-60 using 14198-1-AP

  HL-60 cells were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW264.7 using 14198-1-AP

  RAW264.7 cells were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 14198-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 14198-1-AP (GFI1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

GFI1 Polyclonal Antibody for WB, ELISA

Cat No. 14198-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

GFI 1, GFI1, Zinc finger protein 163, Zinc finger protein Gfi 1, ZNF163

---

Tested Applications

• Positive WB detected in: K-562 cells, HL-60 cells, mouse thymus tissue, PC-3 cells, Raji cells, RAW264.7

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IHC: See 1 publications below

Product Information

14198-1-AP targets GFI1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5401

  Product name: Recombinant human GFI1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-422 aa of BC032751

  Sequence: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPDSCEGSVCERSSEFEDFWRPPSPSASPASEKSMCPSLDEAQPFPLPFKPYSWSGLAGSDLRHLVQSYRPCGALERGAGLGLFCEPAPEPGHPAALYGPKRAAGGAGAGAPGSCSAGAGATAGPGLGLYGDFGSAAAGLYERPTAAAGLLYPERGHGLHADKGAGVKVESELLCTRLLLGGGSYKCIKCSKVFSTPHGLEVHVRRSHSGTRPFACEMCGKTFGHAVSLEQHKAVHSQERSFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCDLCGKGFQRKVDLRRHRETQHGLK

• Full Name: growth factor independent 1 transcription repressor
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 62-66 kDa
• GenBank Accession Number: BC032751
• Gene Symbol: GFI1
• Gene ID (NCBI): 2672
• RRID: AB_2109976
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99684
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GFI is a transcriptional repressor that is transiently induced during T-cell differentiation. It has critical roles in enhancing T helper-2 (Th2) cell expansion and in repressing induction of Th17 and CD103-positive inducible regulatory T (Treg) cells [PMID: 19188499]. GFI1 transcriptional regulator oncoprotein plays a crucial role in hematopoietic, inner ear, and pulmonary neuroendocrine cell development and governs cell processes as diverse as self-renewal of hematopoietic stem cells, proliferation, apoptosis, differentiation, cell fate specification, and oncogenesis (PMID: 18805794). The calculated molecular weight of GFI1 protein is about 45 kDa, but the modification of ubiquitinated GIF1 protein is about 62-66 kDa (PMID: 12721361).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IHC	Nature; Divergent transcriptional regulation of astrocyte reactivity across disorders.; Authors - Joshua E Burda