Product Information
32902-1-PBS targets GFOD1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag37656 Product name: Recombinant human GFOD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 272-390 aa of BC119005 Sequence: APEQELLVQDATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCVVDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYC Predict reactive species |
| Full Name | glucose-fructose oxidoreductase domain containing 1 |
| Calculated Molecular Weight | 390 aa, 43 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC119005 |
| Gene Symbol | GFOD1 |
| Gene ID (NCBI) | 54438 |
| RRID | AB_3742782 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9NXC2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Glucose-fructose oxidoreductase domain 1 (GFOD1), may be linked to the development of ADHD. It plays a role in regulating oxidative stress in ADHD. GFOD1 may contribute to increased levels of oxidative stress specifically in the prefrontal cortex and cerebellar cortex regions and astrocytes affected by ADHD via up-regulation of the NF-κB p65/NOX2/oxidative stress axis (PMID: 40210145). There is a signal peptide at the N-terminal of this protein and the detected double strand in fetal human brain tissue is consistent with PMID: 38946427.
