Aequorea victoria GFP tag Recombinant monoclonal antibody, PBS Only

GFP tag Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 81835-2-PBS
Clone No.241614B3

Host / Isotype

Rabbit / IgG

Reactivity

aequorea victoria, recombinant protein

Applications

WB, IF/ICC, Indirect ELISA

eGFP, GFP, 241614B3, GFP-tag, green fluorescence protein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81835-2-PBS targets GFP tag in WB, IF/ICC, Indirect ELISA applications and shows reactivity with aequorea victoria, recombinant protein samples.

Tested Reactivity aequorea victoria, recombinant protein
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2128

Product name: Recombinant aequorea victoria GFP tag protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-238 aa of M62653

Sequence: MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Predict reactive species
Full Name GFP tag
Calculated Molecular Weight 26 kDa
GenBank Accession NumberM62653
Gene Symbol
Gene ID (NCBI)
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP42212
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Green Fluorescent Proteins (GFPs) encompass a diverse range of proteins carrying a green chromophore, originating from various species and forming different protein lineages. Wildtype GFP consists of 238 amino acid residues (26.9 kDa). GFP was first identified in the jellyfish Aequorea victoria. It emits green light with a peak wavelength of 509 nm upon excitation by blue light at 395 nm. When fused with other proteins, GFP serves as a versatile reporter protein e.g. for quantifying expression levels or facilitates visualization of subcellular localization through fluorescence microscopy. This antibody is generated against the full-length eGFP protein. It exhibits reactivity towards variants of Aequorea victoria GFP, including S65T-GFP, RS-GFP, YFP, CFP, and eGFP.

Loading...
||
New chat Able
正在加载,请稍候...