GFPT2 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• GFPT2 Recombinant monoclonal antibody, PBS Only (86609-3-PBS)

• 

  WB analysis of NIH/3T3 using 86609-3-RR (same clone as 86609-3-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 86609-3-RR (GFPT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86609-3-PBS in a different storage buffer formulation.

• 

  WB analysis of A375 using 86609-3-RR (same clone as 86609-3-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 86609-3-RR (GFPT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86609-3-PBS in a different storage buffer formulation.

• 

  IF Staining of A375 using 86609-3-RR (same clone as 86609-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A375 cells using GFPT2 antibody (86609-3-RR, Clone: 251454E5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86609-3-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 86609-3-RR (same clone as 86609-3-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed NIH/3T3 cells using GFPT2 antibody (86609-3-RR, Clone: 251454E5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 86609-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 86609-3-RR

  Biolayer interferometry (BLl) kinetic assays of 86609-3-RR against Human GFPT2 were performed. The affinity constant is below 1 pM.

GFPT2 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 86609-3-PBS

Clone No.251454E5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

D-fructose-6-phosphate amidotransferase 2, EC:2.6.1.16, GFAT2, glutamine fructose 6 phosphate transaminase 2, Glutamine:fructose-6-phosphate amidotransferase 2

---

Product Information

86609-3-PBS targets GFPT2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7275

  Product name: Recombinant human GFPT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 330-682 aa of BC000012

  Sequence: IFEQPESVFNTMRGRVNFETNTVLLGGLKDHLKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSGETADTLLALRYCKDRGALTVGVTNTVGSSISRETDCGVHINAGPEVGVASTKAYTSQFISLVMFGLMMSEDRISLQNRRQEIIRGLRSLPELIKEVLSLEEKIHDLALELYTQRSLLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMVIMKDPCFAKCQNALQQVTARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFHLAVLRGYDVDFPRNLAKSVTVE

• Full Name: glutamine-fructose-6-phosphate transaminase 2
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 75-77 kDa
• GenBank Accession Number: BC000012
• Gene Symbol: GFPT2
• Gene ID (NCBI): 9945
• RRID: AB_3745004
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O94808
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GFPT2 (Glutamine-fructose-6phosphate transaminase 2) is a rate-limiting enzyme in hexosamine biosynthesis involved in the occurrence and progress of many cancers (PMID: 35330716, 14764791). GFPT2 plays an important role in the metabolic activity of cells, especially in their glucose metabolism. GFPT2 expression was highly correlated with EMT-related factors (PMID: 37395335). High GFPT2 expression is associated with poor prognosis in various tumors, including lung adenocarcinoma, colorectal cancer, leiomyosarcoma, and serous ovarian cancer.