GFRA3 Polyclonal antibody

• 

  WB analysis of mouse heart using 25379-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 25379-1-AP (GFRA3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 25379-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 25379-1-AP (GFRA3 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human heart using 25379-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 25379-1-AP (GFRA3 antibody) at dilution of 1:200 (under 40x lens).

GFRA3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25379-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

GDNF family receptor alpha 3, GDNF receptor alpha 3, GDNFR alpha 3, GFR alpha 3, GFRA3

---

Tested Applications

• Positive WB detected in: mouse heart tissue
• Positive IHC detected in: human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25379-1-AP targets GFRA3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13253

  Product name: Recombinant human GFRA3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 38-379 aa of BC037951

  Sequence: SRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRP

• Full Name: GDNF family receptor alpha 3
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC037951
• Gene Symbol: GFRA3
• Gene ID (NCBI): 2676
• RRID: AB_2880050
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60609
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GFRA3 is a receptor for the glial cell line-derived neurotrophic factor, ARTN (artemin). It mediates the artemin-induced autophosphorylation and activation of the RET receptor tyrosine kinase. GFRA3 has two isoforms with MW 45 kDa and 41 kDa. It can be cleaved to be a mature form with MW 41 kDa or 37 kDa.