GFRA3 Polyclonal antibody

GFRA3 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 25379-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

GDNF family receptor alpha 3, GDNF receptor alpha 3, GDNFR alpha 3, GFR alpha 3, GFRA3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue
Positive IHC detected inhuman heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25379-1-AP targets GFRA3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13253

Product name: Recombinant human GFRA3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 38-379 aa of BC037951

Sequence: SRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACLDIYWTVHRARSLGNYELDVSPYEDTVTSKPWKMNLSKLNMLKPDSDLCLKFAMLCTLNDKCDRLRKAYGEACSGPHCQRHVCLRQLLTFFEKAAEPHAQGLLLCPCAPNDRGCGERRRNTIAPNCALPPVAPNCLELRRLCFSDPLCRSRLVDFQTHCHPMDILGTCATEQSRCLRAYLGLIGTAMTPNFVSNVNTSVALSCTCRGSGNLQEECEMLEGFFSHNPCLTEAIAAKMRFHSQLFSQDWPHPTFAVMAHQNENPAVRP

Predict reactive species
Full Name GDNF family receptor alpha 3
Calculated Molecular Weight 45 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC037951
Gene Symbol GFRA3
Gene ID (NCBI) 2676
RRIDAB_2880050
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60609
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

GFRA3 is a receptor for the glial cell line-derived neurotrophic factor, ARTN (artemin). It mediates the artemin-induced autophosphorylation and activation of the RET receptor tyrosine kinase. GFRA3 has two isoforms with MW 45 kDa and 41 kDa. It can be cleaved to be a mature form with MW 41 kDa or 37 kDa.

Protocols

Product Specific Protocols
IHC protocol for GFRA3 antibody 25379-1-APDownload protocol
WB protocol for GFRA3 antibody 25379-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...