Tested Applications
| Positive WB detected in | HEK-293 cells, mouse brain tissue, rat brain tissue, HeLa cells, SH-SY5Y cells |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25674-1-AP targets GGA1 in WB, IF/ICC, ELISA applications and shows reactivity with human, rat, mouse samples.
| Tested Reactivity | human, rat, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22614 Product name: Recombinant human GGA1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 276-395 aa of BC044629 Sequence: ALGLSDPTPPSGPSLDGTGWNSFQSSDATEPPAPALAQAPSMESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPTPRLTLRDLQNKSSSCSSPSSSATSLLHTVSPE Predict reactive species |
| Full Name | golgi associated, gamma adaptin ear containing, ARF binding protein 1 |
| Observed Molecular Weight | 70-72 kDa |
| GenBank Accession Number | BC044629 |
| Gene Symbol | GGA1 |
| Gene ID (NCBI) | 26088 |
| RRID | AB_2880188 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UJY5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for GGA1 antibody 25674-1-AP | Download protocol |
| WB protocol for GGA1 antibody 25674-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The GGA1 Polyclonal antibody (Cat# 25674-1-AP) has 5 citations across J Clin Invest, Sci Adv, Cell Rep, Environ Toxicol, and J Biol Chem. Research fields include cancer biology (secretory addiction, GIST oncogenic signaling), viral replication (SARS-CoV-2 envelope trafficking), tendon-bone healing and osteogenic differentiation, and endosomal compartment localization. All citations used WB; one also employed IF.
| Species | Application | Title |
|---|---|---|
J Clin Invest Chromosomal 3q amplicon encodes essential regulators of secretory vesicles that drive secretory addiction in cancer | ||
Sci Adv ER-export and ARFRP1/AP-1-dependent delivery of SARS-CoV-2 Envelope to lysosomes controls late stages of viral replication | ||
Cell Rep Golgi retention and oncogenic KIT signaling via PLCγ2-PKD2-PI4KIIIβ activation in gastrointestinal stromal tumor cells
| ||
Environ Toxicol Total flavonoids of Rhizoma drynariae improves tendon-bone healing for anterior cruciate ligament reconstruction in mice and promotes the osteogenic differentiation of bone mesenchymal stem cells by the ERR1/2-Gga1-TGF-β/MAPK pathway | ||
J Biol Chem GGA1 interacts with the endosomal Na+/H+ exchanger NHE6 governing localization to the endosome compartment |
Reviews
What customers say
The single review for 25674-1-AP (GGA1 antibody) received a 5-star rating. The user performed immunofluorescence on PFA-fixed HeLa cells using a 1:500 dilution with an Alexa Fluor 594-conjugated goat anti-rabbit secondary antibody, reporting successful staining. Overall, the feedback is positive, indicating the antibody works well for IF applications at the tested dilution.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Cristian (Verified Customer) (04-17-2019) | Immunofluorescent analysis of (PFA 3%) fixed HeLa cells using 25674-1-AP (GGA1 antibody) at dilution of 1:500 and Alexa Fluor 594-conjugated Affinipure Goat Anti-Rabbit IgG (H+L)
 |
