GGA3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GGA3 Polyclonal antibody (33639-1-AP)

• 

  WB analysis using 33639-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33639-1-AP (GGA3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 33639-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using GGA3 antibody (33639-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

GGA3 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 33639-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ADP-ribosylation factor-binding protein GGA3, Golgi-localized, gamma ear-containing, ARF-binding protein 3, KIAA0154

---

Tested Applications

• Positive WB detected in: A549 cells, Calu-1 cells, SH-SY5Y cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33639-1-AP targets GGA3 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38658

  Product name: Recombinant human GGA3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 363-550 aa of NM_138619.3

  Sequence: SGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLLQREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAGSSLFSTGVAPALAPKVEPAVPGHHGLALGNSALHHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPL

• Full Name: golgi associated, gamma adaptin ear containing, ARF binding protein 3
• Calculated Molecular Weight: 78kDa，723aa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: NM_138619.3
• Gene Symbol: GGA3
• Gene ID (NCBI): 23163
• RRID: AB_3743035
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9NZ52
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Golgi-associated, gamma-adaptin ear-containing, ARF-binding protein 3 (GGA3) is a monomeric clathrin adaptor that localizes predominantly to the trans-Golgi network (TGN) and endosomal membranes. Beyond classical cargo sorting, GGA3 participates in receptor recycling, retrograde transport and signal termination. Notably, caspase-3 cleaves GGA3 during apoptosis or cerebral ischaemia; loss of this adaptor stabilises β-secretase (BACE1), thereby increasing amyloid-β production and linking GGA3 to Alzheimer disease pathogenesis. Recent work further implicates GGA3 in oncogenic processes: in non-small-cell lung cancer it supports TrkA trafficking to the plasma membrane, prolonging Akt/ERK signalling and promoting cell survival.(PMID: 39267722, PMID: 37586201)