GGN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• GGN Polyclonal antibody (32984-1-AP)

• 

  WB analysis using 32984-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32984-1-AP (GGN antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

GGN Polyclonal Antibody for WB, ELISA

Cat No. 32984-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Gametogenetin

---

Tested Applications

• Positive WB detected in: Calu-1 cells, A549 cells, HT-1080 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32984-1-AP targets GGN in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38372

  Product name: Recombinant human GGN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 200-381 aa of NM_152657.3

  Sequence: TESQAGPRNQGQTAGRARGGAPPHAGEGEMAQPADSESGLSLLCKITFKSRPSLAPPAASSSLAAKASLGGGGGGGLFAASGAISYAEVLKQGPLPPGAARPLGEVSRGAQEAEGGDGDGEGCSGPPSAPASQARALPPPPYTTFPGSKPKFDWVSAPDGPERHFRFNGAGGGIGAPRRRAA

• Full Name: gametogenetin
• Calculated Molecular Weight: 67kDa，652aa
• Observed Molecular Weight: 65 kDa, 70 kDa
• GenBank Accession Number: NM_152657.3
• Gene Symbol: GGN
• Gene ID (NCBI): 199720
• RRID: AB_3742813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q86UU5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Human gametogenetin (GGN) is expressed in the testis and ovaries and is a conserved gene in human and mouse. Recently, GGN was found to play a tumor-promoting role in cancer through regulation of NFκB/caspase-3-mediated apoptosis signaling (PMID: 30721393). GGN can be glycosylated, which may result in an increase in observed molecular weight.