GGT1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83304-1-RR (same clone as 83304-1-PBS)

  Human kidney tissue were subjected to SDS PAGE followed by western blot with 83304-1-RR (GGT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83304-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 83304-1-RR (same clone as 83304-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 83304-1-RR (GGT1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83304-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 83304-1-RR (same clone as 83304-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 83304-1-RR (GGT1 antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83304-1-PBS in a different storage buffer formulation.

• 

  IHC staining of Human Kidney(renal cell) Cancer using 83304-1-PBS

  Immunohistochemical analysis of paraffin-embedded Human Kidney(renal cell) Cancer slide using 83304-1-PBS (GGT1 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 83304-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 83304-1-PBS against Human GGT1 was performed. The affinity constant is 1.86 nM.

GGT1 Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 83304-1-PBS

Clone No.230428B5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

230428B5, CD224, D22S672, D22S732, GGT

---

Tested Applications

• Positive IHC detected in: Human Kidney(renal cell) Cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Product Information

83304-1-PBS targets GGT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34209

  Product name: Recombinant human GGT1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 381-470 aa of NM_013430

  Sequence: TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG

• Full Name: gamma-glutamyltransferase 1
• Calculated Molecular Weight: 61 kDa
• Observed Molecular Weight: 24 kDa
• GenBank Accession Number: NM_013430
• Gene Symbol: GGT1
• Gene ID (NCBI): 2678
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P19440
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

GGT1 is a transpeptidase whose activity increases the availability of amino acids, primarily cysteine, for intracellular GSH synthesis. GGT1 also plays a critical role in maintaining GSH homeostasis and defense against oxidative stress. In liver and obstructive biliary diseases, circulating GGT1 activity has widely been used for diagnosis purposes, as well as an indicator of alcohol consumption. (PMID: 31151999)