Tested Applications
| Positive IHC detected in | Human Kidney(renal cell) Cancer Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Product Information
83304-1-PBS targets GGT1 in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag34209 Product name: Recombinant human GGT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 381-470 aa of NM_013430 Sequence: TAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILFNNEMDDFSSPSITNEFGVPPSPANFIQPGKQPLSSMCPTIMVGQDGQVRMVVG Predict reactive species |
| Full Name | gamma-glutamyltransferase 1 |
| Calculated Molecular Weight | 61 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | NM_013430 |
| Gene Symbol | GGT1 |
| Gene ID (NCBI) | 2678 |
| RRID | AB_3670973 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P19440 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
GGT1 is a transpeptidase whose activity increases the availability of amino acids, primarily cysteine, for intracellular GSH synthesis. GGT1 also plays a critical role in maintaining GSH homeostasis and defense against oxidative stress. In liver and obstructive biliary diseases, circulating GGT1 activity has widely been used for diagnosis purposes, as well as an indicator of alcohol consumption. (PMID: 31151999)
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for GGT1 antibody 83304-1-PBS | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |









